SKU: 25611412820

Human Stratifin/14-3-3 sigma Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Stratifin/14-3-3 sigma Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1 Accession P31947 Amino Acid Sequence Protein sequence (P31947, Met1 Ser248, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1
Accession P31947
Amino Acid Sequence

Protein sequence (P31947, Met1-Ser248, with C-His Tag) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Expression System E.coli
Molecular Weight Predicted MW: 29.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein sigma (SFN), also known as Stratifin, is a crucial member of the 14-3-3 family. It functions as a phospho-serine/phospho-threonine binding protein that regulates a wide array of cellular processes, including cell cycle progression, apoptosis, and stress response. A key and well-characterized role of 14-3-3 sigma is its involvement in the DNA damage checkpoint, where it is transcriptionally activated by p53 and helps arrest the cell cycle. It often acts as a tumor suppressor, and its expression is frequently lost in various cancers through epigenetic silencing. Furthermore, 14-3-3 sigma is implicated in epithelial cell biology and is a significant marker in cancer research and diagnosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25611412820

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LoveCoates
Bozeman, US
★★★★★ 5
Best text about an essential therapeutic method
Group therapy is, in my opinion, a criminally neglected and underrated tool in the toolset of psychotherapy and medicine. Group reveals our attachment style and communication patterns with a clarity, efficiency, and force that no other form of psychological intervention can match -- every person on the planet should spend some time in a group dealing with his or her mental and/or emotional issues. The world would be a better place. Irv Yalom probably knows more about group than any other person, and this guidebook is essential to anybody wanting to understand the form. Yalom explains group thoroughly, in an understandable but frequently profound manner. The main drawback is that the book may even be overly comprehensive, and its length is likely to intimidate non-professionals, which is a shame because the benefits of group need wider dissemination.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2013
D
Verified Purchase
Dr. T
Belleville, US
★★★★★ 5
Yalom's Group Therapy "Bible" continues to be the gold standard in group work.
I have used Yalom's Group Therapy book since my doctoral training in the early 90's. His work is timeless and it is clear he is an individual who understands the heart and the soul of our work. I created and facilitate a 18 - 20 week Relationship Academy which is part didactic and part experiential. It is amazing to see the group dynamics play out as expected based on Yalom's work. I will often read from this text in the morning, so that my mind is prepared for the day. It often changes my perspective and opens my eyes to considering different interpretations of behavior and it encourages me to silence myself and allow the "process" to work. How very rewarding this is! I don't see how serious group work can be done without Yalom's influence. Thank you so much for the updated text. Barbara Tobias, PhD, MSN, RN, Clinical Psychologist and CEO of New Perspectives Psychotherapy and Consulting, Camp Springs MD.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2012
T
Verified Purchase
theonetrueyalom
Lake Worth, US
★★★★★ 4
Needs to be updated
Format: Hardcover
Excellent book, but now that it is 2019, it needs to be updated to reflect the current health care system. This book details average inpatient hospitalization stays as 10-90 days. The current average length of stay at an inpatient hospital is 3-15 days. So a lot of the information about how to run groups was not as applicable now - in the book, it assumed patients would be together in groups for weeks, but the reality is that sometimes patients are only together for a day or two.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2019
E
Verified Purchase
Erin
Dallas, US
★★★★★ 5
Good
Format: Hardcover
Good quality used item. Good to read about Yalom's work in IP Psych.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2025
N
Verified Purchase
Nikki Katz
Natrona Heights, US
★★★★★ 5
Yalom Still Rules
Yalom is as relevant today as ever. Writing with art for science, Yalom offers insights and wisdom for clinical group practice that have changed the way I approach my whole life. If you have the luck to read this as an assigned text, you may be relieved by his novelistic approach and his integration of existential philosophy. If you are looking for the deep dive, he’s your guy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2021

recommand products