SKU: 36787889729

Mycobacterium tuberculosis fbpA/Ag85A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mycobacterium tuberculosis fbpA/Ag85A Protein, His TagProduct Specification Synonyms Diacylglycerol acyltransferase mycolyltransferase Ag85A, DGAT, Acyl CoA: diacylglycerol acyltransferase, Antigen 85 complex A (85A; Ag85A), Fibronectin binding protein A (Fbps A), mpt44, MT3911 Accession P9WQP2 Amino Acid Sequence Protein sequence (P9WQP2, Phe44 Ala338, with N His Tag)

Product Specification


Synonyms Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex A (85A; Ag85A), Fibronectin-binding protein A (Fbps A), mpt44, MT3911
Accession P9WQP2
Amino Acid Sequence

Protein sequence (P9WQP2, Phe44-Ala338, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Expression System HEK293
Molecular Weight Predicted MW: 33.3 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ag85A, a member of the Antigen 85 complex, is a pivotal mycolyltransferase secreted by Mycobacterium tuberculosis and other mycobacteria. This enzyme is essential for constructing the unique, impermeable mycobacterial cell wall. It catalyzes the transfer of mycolic acids—long-chain fatty acids critical for pathogenicity—onto the arabinogalactan layer of the cell envelope, forming a protective lipid barrier. Ag85A also exhibits diacylglycerol acyltransferase activity, contributing to trehalose dimycolate (cord factor) synthesis. As one of the most abundant and immunodominant proteins secreted by the bacillus, Ag85A is a major target of the host immune response and a leading candidate for subunit vaccines against tuberculosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36787889729

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
sunnyberry
Carnegie, US
★★★★★ 5
I LOVE this sunscreen!! Super affordable and lightweight for your skin!
Size: 6 Fl Oz (Pack of 1), Style: SPF 50
I love this sunscreen!! Love it so much I bought 3 bottles of it! Super lightweight and blends right into the skin, and I don’t feel not sticky! I got super excited and got this primarily because it’s lightweight, super affordable, SPF 50 for high protection, and it said there’s no alcohol or fragrance…heres the catch tho, there IS a slight sunscreen smell, but you only notice it when applying it and if you keeping smelling it on yourself up close during the day. Other than that, it’s truly fragrance free in the sense that you aren’t just standing there doing your thing, and keep getting HIT with the scent of sunscreen for hours, like other sunscreens! The scent is extremely light and pleasant when you go to smell it on yourself. Don’t EVER discontinue this please please please!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
L
Verified Purchase
Lemonie
Louisville, US
★★★★★ 5
It’s great! So light weight!
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
I have been testing this out for a month now. I love it. This does have avobenzone in it, and because of that, I do NOT put it around my eyes as avobenzone is a chemical sunscreen ingredient that typically tends to cause the of sensation of burning eyes! At least for me it does. I use an Australian sunscreen around my eyes that doesn’t have anything that irritates my eyes. So for the rest of my face, this stuff is great. It literally is so serum like sinks into your skin within five minutes or sooner. Now it’s not the most hydrating thing in the world so if you have a dry skin, you still wanna go in with a moisturizer before however, if you have oily skin, this is your girl right here. Skin like finish, not super matte and not dewy at all. I do not wear primer so I don’t know how it plays with that. Works great under my makeup and has never caused pilling. Quick, easy, simple ingredients, definitely sensitive skin friendly, and no fragrance at an affordable cost-effective price! Now if only banana boat decided to go cruelty free😭 9/10 bc not CF 💔
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
L
Verified Purchase
Linsey R.
Lowell, US
★★★★★ 5
Great sensitive skin sunscreen
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
Love this! I have sensitive skin. this did not sting my eyes, or burn my cheeks. Left no white cast. I'm not noticing any scent. It just feels like bare skin, it's not heavy, drying, oily or sticky. No pilling. Went on smooth, not streaky, looks like skin once dried down, not patchy. I hope they keep this in stock forever!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
J
Verified Purchase
Jenai Morris
Houston, US
★★★★★ 5
Lightweight and Effective
Style: SPF 70, Size: 8 Fl Oz (Pack of 1)
I love how lightweight and comfortable this sunscreen feels on my skin. The appearance leaves a nice glow without looking greasy or heavy. The bottle size lasts a long time and it’s very easy to apply evenly. It also smells amazing compared to other sunscreens. Definitely worth the money and perfect for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
T
Verified Purchase
Theo McLain
Louisville, US
★★★★★ 5
Good!
Style: SPF 70, Size: 8 Fl Oz (Pack of 1)
Works well! Love the subtle shimmer and glow it gives me. Doesn’t leave a white cast, but definitely does feel a little oily on the skin. Smells very nice too, not that classic chemical sunscreen smell at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products