SKU: 13524849629

CD30/TNFRSF8 His Tag Protein, Human

Sale price$187.20 Regular price$208.00
Save 10%

Pay in installments of $52.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD30/TNFRSF8 His Tag Protein, HumanProduct Specification Species Human Synonyms TNFRSF8, CD30, D1S166E, Ki 1 Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal 8* His

Product Specification


Species Human
Synonyms TNFRSF8, CD30, D1S166E, Ki-1
Accession P28908
Amino Acid Sequence

Phe19-Lys379, with C-terminal 8* His FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

72-89kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Feghali-Bostwick C A. et al. (2008) Autoantibodies in patients with chronic obstructive pulmonary disease. American Journal of Respiratory and Critical Care Medicine. 177(2): 156-163.

2、Wang G N. et al. (2017) Prognostic significance of CD30 expression in nasal natural killer/T-cell lymphoma. Oncology Letters. 13(3): 1211-1215.

3、Horie R. et al. (1998) A novel domain in the CD30 cytoplasmic tail mediates NFκB activation. International Immunology. 10(2): 203-210.

4、Xu M L. et al. (2020) Practical approaches on CD30 detection and reporting in lymphoma diagnosis. Am J Surg Pathol. 44(2): 1-14.

Background

CD30, a member of the tumor necrosis factor receptor superfamily, also known as Ki-1, is a kind of type I transmembrane glycoprotein. The CD30 protein is composed of 595 amino acids, and the cytosolic and transmembrane region in the protein are composed of 188 amino acids and 24 amino acids, respectively. The extracellular region is the leading peptide of 18 amino acids, followed by 365 amino acids. CD30 is widely expressed in viral-infected lymphocytes and lymphoma cells and activated T cells. Moreover, CD30 is also expressed in alveolar macrophages, epidermal cells, activated NK cells, decidual cells, resting B cells, granulocytes, thymocytes, and medulla cells. The bind of CD30 and CD30L induces the production of cytokine, which promotes cell proliferation, differentiation, cell growth, stagnation, and death. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis. CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). CD30 ligation leads to nuclear factor-kappa B (NFκB) and/or mitogen-activated protein kinase (MAPK) pathways, ultimately leading to survival of neoplastic cells. CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13524849629

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sue
Dallas, US
★★★★★ 5
Great Book
Format: Board book
Bought for my one year old niece. She loves the bright pictures and being able to push the button to make the animal sounds. Great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2024
M
Verified Purchase
Michael
Carnegie, US
★★★★★ 4
Fun animal book with Eric Carle illustrations!
Format: Board book
Some of the noises the animals make feel a little strange, but my toddler loves to push the buttons! I do like that it says the name of the animal before making the sound the animal makes - gives some vocabulary practice when my daughter is reading independently.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 23, 2025
D
Verified Purchase
dlkoosher
West Palm Beach, US
★★★★★ 5
All the grandkids enjoy these, of various ages.
Format: Board book
The grandkids always enjoy Eric Carle sound books. The older one reads the stories and the younger one likes to just push the buttons and listen and then say what the animal is. The sound is always nice and clear and the photos on the buttons are easily recognizable. As an added bonus these were offered at a great holiday price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2025
M
Verified Purchase
melanie
Omaha, US
★★★★★ 5
Highly recommend
Format: Hardcover
My son is 11 years old . He loved this Shark book . Its hard cover is sturdy . It’s made high quality. The audio is perfect pitch and clear . Teaches about each shark .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
T
Verified Purchase
Thea Desiree
West Palm Beach, US
★★★★★ 5
Shark book with read along buttons
Format: Hardcover
Best read along shark book ! My toddler loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products