SKU: 90764207451

LRP10 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LRP10 His Tag Protein, HumanProduct Specification Species Human Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7Z4F1 Amino Acid Sequence His17 Lys440, with C terminal 10*His

Product Specification


Species Human
Synonyms LRP10, LRP9, MST087, MSTP087
Accession Q7Z4F1
Amino Acid Sequence His17-Lys440, with C-terminal 10*His HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRKGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 56-66kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Manini A. et al. (2021) Screening of LRP10 mutations in Parkinson's disease patients from Italy. Parkinsonism Relat Disord. 89: 17-21.

Background

Parkinson's disease (PD) is a neurodegenerative disorder characterized by resting tremor, bradykinesia, muscle rigidity, and abnormal gait. Parkinson's disease (PD) belongs to a family of neurodegenerative diseases characterized by alpha-synuclein accumulation in neurons. LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. The low-density lipoprotein receptor-related protein 10 (LRP10) was recently shown to be a causal gene for PD, and different ethnic cohorts have distinct frequencies and spectrum of LRP10 variants.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90764207451

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Evans Nexsen
Whiting, US
★★★★★ 5
Most Useful and Applicable Toddler Book I’ve Found
Format: Kindle
Goodwin’s series continues to be one of my favorite parenting tools I’ve found. While my toddler loves the images and messaging, Goodwin’s applicable and usable tip list in the back of her books is the secret sauce that sets her apart. A must for caregivers of young children!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
S
Verified Purchase
Stephanie
Draper, US
★★★★★ 5
Great book!
Format: Board book
My daughter and I have read this book at least 20 times! So many helpful ideas!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
J
Verified Purchase
Jennifer R
Phoenix, US
★★★★★ 5
Love all the books from this author!
Format: Board book
Love this author and all of her books.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
M
Melissa
Lake Worth, US
★★★★★ 5
Perfect toddler book for teaching big emotions and calm down techniques in a simple, visual way
Format: Board book, Format: Board book
What I received / first impressions: This is a picture book written for toddlers and young children that walks through what big emotions feel like, where you feel them in your body, and what to do when they show up. It is written in a way that is easy for kids to follow along with a parent and includes practical techniques they can actually use in the moment. What I liked: - Perfectly written for young kids: The language and pacing are just right for toddlers to stay engaged and understand without getting lost. - Teaches body awareness around emotions: I love that it helps children recognize where in their body they feel emotions, which is such a foundational skill for emotional regulation. - Covers a full range of emotions: It addresses big feelings that come from both difficult and happy moments, and acknowledges that emotions show up differently for everyone which is an important and inclusive message. - Interactive and easy to practice at home: This is something you can do together as a family, not just read and set aside. The techniques are simple enough for little ones to actually try. - Parent tips included in the back: The added section for parents on how to integrate the techniques into daily life is a thoughtful bonus that makes this more than just a read-aloud. - Great addition alongside other behavior books: We are fans of the Best Behavior series like Teeth Are Not for Biting and Hands Are Not for Hitting and this fits right in alongside those in both tone and approach. What I didn't like / concerns: Nothing. This book delivered exactly what we needed and then some. Who I think this is best for: - Parents of toddlers and young children looking for a practical, visual tool for emotional regulation - Families who already enjoy behavior and feelings books and want to add to their collection - Anyone looking for a book they can actively use with their child rather than just read to them - Teachers or caregivers working with young children on identifying and managing big emotions Bottom line: This book has genuinely helped us work through big emotions at home in a way our child can understand and participate in. It is visual, approachable, and gives both kids and parents real tools to use together. We are so glad we found it and it has earned a permanent spot in our regular reading rotation. Would I buy again? Yes, and would gift it to other parents of young children without hesitation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
T
Verified Purchase
Tonya
Charlottesville, US
★★★★★ 5
Toddlerhood is a journey you should enjoy
Format: Hardcover, Format: Hardcover
Toddlerhood is a completely different game from the newborn or the curious infant. But it's not just "the terrible twos," or the throw down to the ground tantrums. It's learning and doing so together and finding joy every day. As a single mom, i was looking for parenting advice and books and felt like I was continuously getting let down. I liked a little from a couple of different topics, but it felt like no one was really connecting to what I wanted to represent. I read the book transforming toddlerhood, and was so happy. Not only does the book have great advice, but actual real situation suggestions and free available resources you can download and use. My coparent and I have both read it. We love that you can do sections at a time, the easy and relatable language and small laughs of how on point Devon is. Really the only toddler parenting book you need!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025

recommand products