Pay in installments of $60.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
C1qR1/CD93 His Tag Protein, HumanProduct Specification Species Human Synonyms C1q MBL SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix remodeling associated protein 4 Accession Q9NPY3 Amino Acid Sequence Thr22 Lys580, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4 |
| Accession | Q9NPY3 |
| Amino Acid Sequence | Thr22-Lys580, with C-terminal 8*His TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 88-95kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Greenlee-Wacker M C. et al. (2011) Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 187: 3353-3361. 2、Nepomuceno R R. et al. (1997) cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 6: 119-129. 3、Nepomuceno R R. et al. (1998) C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 160: 1929-1935. |
Background
Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 27 reviews
Sort
Product Reviews
★★★★★ 5
Bathroom sets
Size: Dark Gray
Love love this set just had our downstairs bathroom redone the quality the 2 trash cans are great big one. Small one and the valve is great the color is great is got the dark grey along with soap dish cup and toliet bowl cleaner love the top of trash can
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
★★★★★ 4
Aesthetic & suprising!
The best part about this is the very sturdy stainless steele stick on hooks that you can put on your mirror, shower etc. I love them right there on the mirror to hang my hair towels on. The containers in the set are sturdy but light weight and seem durable. The stainless painted portion of the containers is pretty light so we'll see how it goes in time. I was somehow suprised with the extra smaller garbage can I think I'll use it for my room! I think this set is more versatile than most others I've seen on Amazon and definetly has a nicer aesthetic design! I think for the price, the value is good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2024
★★★★★ 5
Bathroom set
Size: Dark Gray
Love it would buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
★★★★★ 5
High quality for a low price.
I forgot that it was an 8 piece set, so when I received it I was delighted. It is beautiful, well made, and of good quality for a low price. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024
★★★★★ 5
Love this item
These are super cute in my bathroom. Easy to clean. Perfect for a bathroom set.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2025