Pay in installments of $50.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Synonyms | Ng, RC3, NRGN |
| Accession | Q92686 |
| Amino Acid Sequence | Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 34.5 kDa Observed MW: 43 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-hFc tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy