SKU: 93469388086

FABP6 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag Protein, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93469388086

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dr. T
Fort Morgan, US
★★★★★ 5
Yalom's Group Therapy "Bible" continues to be the gold standard in group work.
I have used Yalom's Group Therapy book since my doctoral training in the early 90's. His work is timeless and it is clear he is an individual who understands the heart and the soul of our work. I created and facilitate a 18 - 20 week Relationship Academy which is part didactic and part experiential. It is amazing to see the group dynamics play out as expected based on Yalom's work. I will often read from this text in the morning, so that my mind is prepared for the day. It often changes my perspective and opens my eyes to considering different interpretations of behavior and it encourages me to silence myself and allow the "process" to work. How very rewarding this is! I don't see how serious group work can be done without Yalom's influence. Thank you so much for the updated text. Barbara Tobias, PhD, MSN, RN, Clinical Psychologist and CEO of New Perspectives Psychotherapy and Consulting, Camp Springs MD.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2012
T
Verified Purchase
theonetrueyalom
Los Angeles, US
★★★★★ 4
Needs to be updated
Format: Hardcover
Excellent book, but now that it is 2019, it needs to be updated to reflect the current health care system. This book details average inpatient hospitalization stays as 10-90 days. The current average length of stay at an inpatient hospital is 3-15 days. So a lot of the information about how to run groups was not as applicable now - in the book, it assumed patients would be together in groups for weeks, but the reality is that sometimes patients are only together for a day or two.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2019
E
Verified Purchase
Erin
Birmingham, US
★★★★★ 5
Good
Format: Hardcover
Good quality used item. Good to read about Yalom's work in IP Psych.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2025
N
Verified Purchase
Nikki Katz
New York, US
★★★★★ 5
Yalom Still Rules
Yalom is as relevant today as ever. Writing with art for science, Yalom offers insights and wisdom for clinical group practice that have changed the way I approach my whole life. If you have the luck to read this as an assigned text, you may be relieved by his novelistic approach and his integration of existential philosophy. If you are looking for the deep dive, he’s your guy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2021
H
Verified Purchase
Holley Noel
Phoenix, US
★★★★★ 5
Great buy!
We utilized this text during my Group Psychology course in my masters program. I felt it was very informative and is referred to highly by several of my colleagues. I had sold the text back to my campus book store a few years ago, but have decided I will benefit from having a copy available to me over my development as a professional. The information within this text, specifically the theories described by Yalom, are also incorporated into the state licensure exam, so it is a good reference to have when studying for this exam as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2012

recommand products