SKU: 55328989763

FABP1 His Tag Protein, Human

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage

Product Specification


Species Human
Synonyms LFABP
Accession P07148
Amino Acid Sequence Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity >95% by SDS-PAG E& RP-HPLC
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55328989763

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
bbiearman
Charlottesville, US
★★★★★ 4
Great toy for larger dogs
Size: 8 Inch, Color: Pink
This is holding up pretty well with my Great Pyrenees pup. She was able to pull all of the tags off-but the ball is intact for several weeks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
C
Verified Purchase
Cmarr
Grantham, US
★★★★★ 5
QDAN has great durable dog toys
Size: 8 Inch, Color: Yellow
It’s very durable ball lots of fun for dogs
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
B
Verified Purchase
Brown
Waukegan, US
★★★★★ 5
So much fun
Size: 8 Inch, Color: Pink
Best money ever spent hours of fun. We have 3 dogs. They all love to play with this toy. We got the size 3 large is what we ordered. I'm not going to lie I thought it would be bigger when I ordered it. Two of our dogs are large breeds and the other is medium. It's not too big for the medium to play with it. It comes with a ball pump included so convenient. The little tabs are very durable. I can't recommend this enough. This has no squeaking or any sounds. It's nice that you can play with your four legged companion or you can have them play tug or just enjoy pushing the ball around. It is very versatile in play and stimulation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2025
A
Verified Purchase
allyson handabaka
Bozeman, US
★★★★★ 3
Not for chewers
Size: 8 Inch, Color: Yellow, Size: 8 Inch, Color: Yellow
My dog managed to pop this and completely chew through it in a matter of 4 days. It was definitely cute and she loved the size of it but with her chewing all the way to the core we have to get rid of it. I thought it was a good material but I guess I was wrong. Kind of sad considering the money spent only lasted 4 days
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
J
Verified Purchase
Jessica
Carnegie, US
★★★★★ 5
Great dog toy
Size: 8 Inch, Color: Pink
The amount of stupid and cute these dogs look like when they shake this ball and smack their own faces! It took a hot second for either dog to understand where to bite on the ball, but now that they do, they both will play with it for a while. Great purchase, came with a pump to blow the ball up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products