SKU: 11430816819

FABP7 His Tag Protein, Human

Sale price$288.00 Regular price$320.00
Save 10%

Pay in installments of $80.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP7 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Fatty acid binding protein 7
Accession O15540
Amino Acid Sequence Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11430816819

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tori Knox
Houston, US
★★★★★ 5
SO durable & my Blue Heeler LOVES it!
Color: Purple, Color: Purple
My Blue Heeler tears up almost all of her toys if they’re not rubber. This ball is SO durable and she loves it so much!! We’ve had it for 5 months now. She chews on it every day for long periods of time and it’s showing pretty much no wear and tear. I keep wondering if I’ll ever have to pull out the second one from the box lol. It can be hard to squeak with one hand, but it’s easy enough with 2 hands or if you step on it with your foot. It’s hilarious that every time I squeak it she licks her lips. My girl never actually squeaks it while she’s chewing on it, which is actually a plus cuz it doesn’t get annoying when she’s chewing on it for long periods of time. I also love that the ball helps clean her teeth because of the spikes and the size is larger so it’s easy to take it from her while playing fetch. Overall a fun, durable dog toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
N
Verified Purchase
Nada Talvy
Cuba, US
★★★★★ 5
Totally indestructible!
Color: Purple, Color: Purple
Finally! A toy my aggressive chewer cannot destroy!! Can’t even get the squeaker out! No other toy has ever held up and it’s got some nice bounce to it. Perfect size so it can’t get stuck under the sofa. Furthermore, it aids in cleaning his teeth and he loves them. This is a great money saver too! Update - 3 months later - still pup’s fav…still whole - still lotsa bounce - still has squeaker intact. As good as new! I’d buy these again but don’t need to 😃!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
J
Verified Purchase
J. Cobb
Whiting, US
★★★★★ 5
Toughest ball of this type.
Color: Blue
My dogs are brutal with these toys. I really like them as the spikes act as a tooth brush, and the dogs love knawing on them. There are other spiked balls like this on amazon, but this one is of better quality. It lasts a lot longer. The squeaker does not last long, the dogs teeth push it into the ball, you can hear it rattling around in there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
G
Verified Purchase
Georgia
Bozeman, US
★★★★★ 4
Very good for aggressive chewers
Color: Red, Blue, Green, Yellow
Finally found ball that my aggressive chewer doesn't destroy. Has loud squeaker however he broke after 4 days. Probably better, noise gone. Very sturdy and he loves. Also big so doesn't roll under furniture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2025
S
Verified Purchase
Samantha Anthony
Bozeman, US
★★★★★ 5
Durable
Color: Purple
I bought this for my 80lb 1yr American Bully male,who has made it his mission to test all the toys his dad and I have bought. Now I have 3 other American Bullies, siblings 3yr old 2 females/1male, who did the same at that age and I mastered toy shopping or so I thought. Lol. My new pup loves balls and this is the only one he firstly can't fit completely in his mouth and can't tear it apart. He has tired!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products