Pay in installments of $74.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated CTLA4 His&Avi Tag Protein, HumanProduct Specification Species Human Antigen CTLA4 Synonyms CTLA4,CD152 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 8*His&Avi tag AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 20 27Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical
Product Specification
| Species | Human |
| Antigen | CTLA4 |
| Synonyms | CTLA4,CD152 |
| Accession | P16410 |
| Amino Acid Sequence |
Ala37 - Phe162, with C-terminal 8*His&Avi tag AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE
|
| Expression System | HEK293 |
| Molecular Weight | 20-27Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019). |
Background
Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy