SKU: 84965120781

E-Selectin/CD62E His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

E-Selectin/CD62E His Tag Protein, HumanProduct Specification Species Human Antigen E Selectin CD62E Synonyms SELE, ELAM1, ESEL, LECAM2 Accession P16581 Amino Acid Sequence Trp22 Pro556, with C terminal 10*His

Product Specification


Species Human
Antigen E-Selectin/CD62E
Synonyms SELE, ELAM1, ESEL, LECAM2
Accession P16581
Amino Acid Sequence

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 80-92kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Evan Ales.The biology of E-selectinligands in leukemogenesis. Adv Cancer Res. 2023;157:229-250

Background

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84965120781

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lindsey Newhouse
Alexandria, US
★★★★★ 5
Super Fun
Color: Green
One of the most entertaining things you could buy. The dogs go crazy over it and have so much fun. It's a bit loud on hard floors, but honestly worth it for the laughs. Seems pretty durable too. I have 2 labs; one started out uninterested and the other started off scared of it, but not too long after, they both started going crazy, tossing and carrying it around while it shook.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
M
Verified Purchase
Monica
Charlottesville, US
★★★★★ 4
Great customer service
Bought this for our dog for Christmas! He loved it! It sadly stopped working shortly after. Recently emailed the product site themselves and they sent a new one that week! Great customer service and great toy!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
S
Verified Purchase
sosayspennylane
Cuba, US
★★★★★ 5
Chuckit! Max Glow Ball Dog Toy - A Canine Delight in the Dark!
Size: Small, Pattern Name: Pack of 1
I recently introduced the Chuckit! Max Glow Ball Dog Toy to my furry friend, and it has quickly become a favorite in our playtime routine. Here's why it deserves a glowing 5-star review: **Pros:** **1. Day and Night Fun:** The Max Glow feature of this ball adds an extra layer of excitement to playtime. Whether it's a sunny day or a moonlit night, my dog can enjoy fetching and playing with this ball anytime, making it a versatile and engaging toy. **2. Long-Lasting Glow:** The glow effect lasts surprisingly long, providing extended play sessions even after the sun sets. The consistent glow adds a thrilling element to our nighttime activities, making it a standout feature of this toy. **3. Durable Design:** The Chuckit! Max Glow Ball is built to last. Its durable construction can withstand the enthusiastic chewing and fetching antics of my dog, ensuring longevity and making it a reliable addition to our collection of toys. **4. Easy to Clean:** Cleaning this ball is a breeze. Whether it's muddy paw prints or slobber, a quick rinse under the tap is all it takes to keep the Chuckit! Max Glow Ball looking and feeling fresh for the next round of play. **5. Compatible with Chuckit! Launchers:** The ball is compatible with Chuckit! launchers, adding an extra layer of fun to our play sessions. The launcher allows for longer throws, providing a good workout for my dog and adding an interactive aspect to our outdoor activities. **6. Fetching Favorite:** My dog absolutely loves fetching this ball. The texture and size make it easy for him to carry in his mouth, and the glowing feature captures his attention and keeps him engaged during playtime. **7. Versatile Outdoor Toy:** Whether it's a game of fetch in the backyard, a trip to the park, or an evening stroll, the Chuckit! Max Glow Ball has become our go-to outdoor toy. Its versatility and engaging qualities make it an essential part of our canine adventures. In conclusion, the Chuckit! Max Glow Ball Dog Toy has brought endless joy and excitement to our playtime routine. Its durable design, long-lasting glow, and compatibility with Chuckit! launchers make it a 5-star favorite in my dog's toy collection. If you're looking to add a touch of magic to your dog's play sessions, this glowing ball is a must-have. Let the nighttime playtime adventures begin! 🌙🐾🌟
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2024
S
Verified Purchase
Sheridan Helms
Bozeman, US
★★★★★ 5
I've bought like 20! Love them!!!
Size: Large, Pattern Name: Pack of 1
My dog is obsessed with this ball! Glow in the Dark is super bouncy, easy to spot at night, and tough enough to handle rough play. Perfect for evening fetch sessions—fun for both of us! We have bought about 20 of these so far. I always bring my dog to play fetch at night, and this is perfect if you're playing in a field or beach. Glows in the dark so both you and your dog can see it. The size of the ball is great for my big dog. It is also the perfect type of silicone so that my dog cannot easily tear it apart and chew it, which is GREAT! We do NOT want our dog's ingesting silicone at all. If you have a ball chewer, this ball is perfect and durable. Chewing ability is good and is not too tough but tough enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2025
W
Verified Purchase
Wiledchild
Battle Creek, US
★★★★★ 5
Cane Corso approved....
Size: Large, Pattern Name: Pack of 1
My Cane Corso loves this ball!!! She carries it around in her mouth like a round pacifier. Sometimes I'll wake up with the ball next to my head on my pillow. Lol This is the third one I've bought. She doesn't destroy them at all . Somehow she loses them. Yesterday she had two floating around. Lol. Earlier I gave her one of those hard rubber balls with feet... She destroyed it within minutes. She can skin a tennis ball and chew it in half in about 5 minutes. This ball is by far a favorite toy of her's. And she doesn't chew it to bits . And it glows in the dark which is fun for playing fetch at night. It's very easy to clean. Sometimes I put little snacks inside for her while she's laying down with her ball. I will definitely keep buying these balls everytime we lose one . They make her happy. And that makes me happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products