SKU: 8175398458

IL1RL1/ST2 (isoform A) His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 26 - Jul 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL1RL1/ST2 (isoform A) His Tag Protein, HumanProduct Specification Species Human Synonyms IL1RL1, DER4, FIT 1, IL33R, ST2, ST2L, ST2V, T1 Accession Q01638 Amino Acid Sequence Lys19 Ser328, with C terminal 8*His

Product Specification


Species Human
Synonyms IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Accession Q01638
Amino Acid Sequence Lys19-Ser328, with C-terminal 8*His KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Savenije O E. et al. (2011) Interleukin-1 receptor-like 1 polymorphisms are associated with serum IL1RL1-a, eosinophils, and asthma in childhood. J Allergy Clin Immunol. 127(3): 750-756.

2、Li H. et al. (2000) The cloning and nucleotide sequence of human ST2L cDNA. Genomics. 67(3): 284-290.

Background

ST2, also known as IL-1 R4 and T1, is an Interleukin-1 receptor family glycoprotein that contributes to Th2 immune responses. Human ST2 consists of a 310 amino acid (aa) extracellular domain (ECD) with three Ig-like domains, a 21 aa transmembrane segment, and a 207 aa cytoplasmic domain with an intracellular TIR domain. ST2 is expressed on the surface of mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It binds IL-33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL-33 binding induces the association of ST2 with IL-1R AcP, a shared signaling subunit that also associates with IL-1 RI and IL-1 R rp2. In macrophages, ST2 interferes with signaling from IL-1 RI and TLR4 by sequestering the adaptor proteins MyD88 and Mal. In addition to its role in promoting mast cell and Th2 dependent inflammation, ST2 activation enhances antigen induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8175398458

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jay
Lowell, US
★★★★★ 5
Really helps soothe baby eczema overnight
Size: 11 Ounce (Pack of 1)
This balm worked very well for my baby’s eczema, especially when used at night. It’s thick and moisturizing but not greasy, and it absorbs nicely into the skin. After a few nights of use, I noticed less redness, dryness, and scratching, and my baby seemed more comfortable sleeping. It’s fragrance-free and gentle, which is very important for sensitive baby skin. A little goes a long way, so the jar lasts a good amount of time. If your baby has dry or eczema-prone skin, this is definitely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
S
Verified Purchase
seRAEtonin
Draper, US
★★★★★ 5
Helped with my baby's eczema!!
Size: 11 Ounce (Pack of 1)
Long overdue review but this was a lifesaver for my sons eczema. Before he was diagnosed, I was struggling to find a moisturizer to help soothe his angry red skin and his flare up wasn't going away or lessening at all. My sister whose son also has eczema, suggested I buy this tub after she gave us some to try. It worked! As a first time mom, seeing my 4-5 month old baby suffering from itchy and uncomfortable skin, I was so stressed about finding something that would help him. This body balm was thick and applied daily after his nighttime bath. The large red patches on his body slowly started to dissipate and we were so relieved. He was prescribed steroid cream for worse flare ups but we use this regularly to keep his eczema flare ups to a minimum and avoid steroid use as much as possible. Although sometimes this doesn't work for the more severe flares, so keep that in mind. It's okay to use the steroid cream or eucrisa prescribed by the doctor. Aveeno is a great daily maintenance cream to help keep their skin moisturized and happy. I highly recommend this jar of body balm, it lasts for many months and a little bit goes a long way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
Y
Verified Purchase
Yai Alvarez
Chelsea, US
★★★★★ 5
Very good product. It moisturizes the skin well and helped reduce irritation quickly. I recommend it
Size: 1 Ounce (Pack of 1)
Excellent product. It helped soothe my baby’s dry, irritated skin after just a few uses. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
D
Verified Purchase
Darianny Campos Ramirez
Battle Creek, US
★★★★★ 4
Very gentle and effective for baby’s eczema-prone skin
Size: 1 Ounce (Pack of 1), Size: 1 Ounce (Pack of 1)
This Aveeno baby face cream has worked really well for my baby’s sensitive, eczema-prone skin. I use it daily on the face, especially on dry and irritated areas, and it helps keep the skin soft, calm, and well moisturized. The texture is rich but not greasy, and it absorbs nicely without leaving the skin sticky. I’ve noticed a clear improvement in dryness and redness after consistent use, especially during colder or drier days. I appreciate that it’s gentle, fragrance-free, and suitable for delicate baby skin. It hasn’t caused any irritation or breakouts, which gives me peace of mind when applying it to my baby’s face. A small amount goes a long way, making it great for everyday use. Overall, this is a reliable and soothing face cream for babies who struggle with dryness or eczema. I would definitely recommend it to other parents.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
A
Verified Purchase
Angie Pangie
Grantham, US
★★★★★ 5
Effective for infant Eczema
Size: 11 Ounce (Pack of 1)
100% effective for infant dry skin. its deeply moisturizing with no harshness at all. its a perfect solution. I have repurchased already.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products