SKU: 99563117142

RON/CD136 His Tag Protein, Human

Sale price$277.20 Regular price$308.00
Save 10%

Pay in installments of $77.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 26 - Jul 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RON/CD136 His Tag Protein, HumanProduct Specification Species Human Synonyms RON, CD136, MSP R, MSP receptor, MSPR, MST1R Accession Q04912 Amino Acid Sequence Glu25 Leu571, with C terminal 10*His

Product Specification


Species Human
Synonyms RON, CD136, MSP R, MSP receptor, MSPR, MST1R
Accession Q04912
Amino Acid Sequence Glu25-Leu571, with C-terminal 10*His EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKLGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 35-43&73-80kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Mallakin A. et al. (2006) Gene expression profiles of Mst1r-deficient mice during nickel-induced acute lung injury. Am J Respir Cell Mol Biol. 34(1): 15-27.

2、Welm A L. et al. (2007) The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans. Proc Natl Acad Sci U S A. 104(18): 7570-5.

Background

RON is a receptor tyrosine kinase (RTK) of the MET receptor family that is canonically involved in mediating growth and inflammatory signaling. This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. It had been shown that MST1R/CD136 plays a critical role in Ni-induced lung injury in mice. The overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer patients and significantly increased the accuracy of an existing gene expression signature for poor prognosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99563117142

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jason
Battle Creek, US
★★★★★ 5
Does the job!
Puts in the work! Knocked out my driveway no problem. Unsure about longevity but it’s great for a homeowner. Easy to assemble. Easy to use. Adjustment is nice along with the guide plate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
B
Verified Purchase
B. Colonna
Omaha, US
★★★★★ 4
Takes The Edge Off!
This is a decent product. If you are going to do a lot of edging, or want to do deep trenching to run conduit, etc. this is NOT the product you want. It is electric, so you are tethered to an outlet, and of course, the farther you go on extension cords, the less of the 12 amp juice you get. It also trenches to 1 1/2", which is OK, but not enough to dump conduit, etc. That said, this is a very good edger. Out of the box, it is minimal assembly. You connect the three pieces of the shaft, removing some edge tape from it, and inserting two metal bolts and plastic knobs, similar to most lawn mowers these days. Then you install the plastic handle with another bolt. That's it. For use, you have a lever which you pull up for edging and lower for trenching to adjust the group clearance. You also choose 1", 1/4", or 1 1/2" depth. Then you plug it in. There is a white line on top of the blade cover so you know where the blade is. You just pull the trigger to run the blade, or release the trigger to stop the blade. Be careful not to lose sight of your electric cord so you don't hit it! I edged along my driveway, about 50' on each side, as well as my front of my lawn, so another 85' along the lawn and the apron (both sides). That's over 350'. It cut through the grass and dirt easily. It struggled a couple of times, on some tough mounds of grass, but like any other tool, you don't force it when that happens, just back up and do that area again slowly. If you come too close to blacktop, Belgian block, stone, etc. you will see sparks so you will know. Just keep in mind, this is an edger. You will be left with the severed grass/sod to remove. In my case I was loooong overdue for a edging, so I spent a long time scraping the sod off the pavement with a shovel. I expect with more frequent ending, and now working with a cleaner edge, this will be less of an issue. Either way, that is not on the product, but the state of the lawn. The edger has 2 read wheels and one smaller front wheel so , although this is not like a big, gas-powered curb jumping unit, you have the option of attacking a curb edge from either the blade side or other side of the edger, so you can get real close to a Belgian block curb. I also did the edge where my grass meets my mulched flower bed, but that was more of a trimming than a edge removal. Overall, the Work edger did as good, or better, a job than my string trimmer, and I didn't have to stop every few minutes to rewrap string. Plus it trenched enough to give me a definitive edge, whereas the string edger just cuts into the grass, not a real trench.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2020
L
Verified Purchase
Lynetta Mason
San Leandro, US
★★★★★ 5
Easy to use for a clean looking cut!
I do wish there was a cordless version but I'm so glad I bought this. It took some time to edge everything the first time because I had to cut the lines but it's been a breeze ever since. I just walk the perimeter of the yard and driveway and it does it's job with ease. The front wheel has three settings which determines how far down the blade cuts and the blade has two settings for edging or trenching. The handle is stationary but it can be lifted up or down. There's a guideline on top of the blade guard that helps identify where the blade is going to make the cut. TIP: Lean it back on the back wheels before pulling the trigger and slowly bring it down because it will jump if the blade isn't lined up and touches the concrete. It doesn't roll well in the grass but it's very smooth when rolled on the concrete. It's definitely worth having to give a clean and finished look. It's well built and isn't too heavy but definitely has some weight to it. It's only loud when the blade hits the concrete otherwise it sounds like a drone. The only complaint I have is that I have to watch the cord closely other than that it's the perfect tool to give a clean look to the yard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
M
Verified Purchase
Marc A.
Waukegan, US
★★★★★ 5
Great product for the $$$$
This edger is awesome. Easy to put together. Intuitive. I put it together inside of 10 minutes. Shifted the edger "guide" down, and went to work. This corded electric model is WAYYY cheaper than the battery powered (or gas powered) models, and is absolutely up to the task. Lightweight and maneuverable. Quiet. Easy to store. The motor got a little "bound" when I tried to edge too fast, but the manual had clearly warned me on this - to back up, let the blade get back up to speed, and then edge again. The lawn edges are now straight, well-defined, and immaculate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
J
Verified Purchase
JW
Pawtucket, US
★★★★★ 5
Great edger
This was a gift for someone very picky about their yard. They loved it and said it works great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products