SKU: 48642110694

Human CCL20 Protein, hFc tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CCL20 Protein, hFc tagProduct Specification Species Human Synonyms C C motif chemokine 2, Beta chemokine exodus 1, CC chemokine LARC, Liver and activation regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP 3 alpha), Small inducible cytokine A20, LARC, MIP3A, SCYA20 Accession P78556 Amino Acid Sequence Protein sequence (P78556, Ala27 Met96, with N hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Expression System HEK293

Product Specification


Species Human
Synonyms C-C motif chemokine 2, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Small-inducible cytokine A20, LARC, MIP3A, SCYA20
Accession P78556
Amino Acid Sequence

Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Expression System HEK293
Molecular Weight

Predicted MW: 35 kDa Observed MW: 35 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3α), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48642110694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
bellconnor12
Bozeman, US
★★★★★ 5
Excellent
Format: Kindle
An excellent work on the essential shape of pastoral work. A very convicting and important read for those who work in ministry- prayer, scripture, and spiritual direction will never be demanded of us, but are non-negotiable in order to maintain our call.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2024
J
Verified Purchase
James Grimes
Lake Worth, US
★★★★★ 5
A must read for any pastor or spiritual leader
Format: Paperback
This book is profoundly insightful and easy to read and understand. It is not heavily theological (and does not need to be). It is practical. I have purchased an additional copy to give my pastor for his birthday. If he has already read it, he can pass it on. EVERY pastor needs to read this and practice these tips, which many do not receive in seminary. THIS is the type of pastor I want and need (and my pastor does embody much of what Peterson describes). I think pastors should read this every year or two to reassess their progress toward keeping these goals always in mind and in practice as much as possible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2019
M
Verified Purchase
Michael F. Nelson
Waukegan, US
★★★★★ 4
A still timely writing for all pastors
Format: Paperback
Although first published 25 years ago, Peterson addresses a matter that is still timely, the need for all pastors to commit themselves to prayer, reading scripture and spiritual direction. These, Peterson asserts, are an essential foundation for all other aspects of ministry. Peterson's premise, that many pastors have abdicated their primary calling to these three practices, is still very relavent to the current state of pastoral ministry. Its content will be useful for new and veteran pastors alike.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2013
C
Verified Purchase
C S Berry
Phoenix, US
★★★★★ 5
Transformative if you are willing.
Format: Kindle
The triangle of pastoral ministry - Scripture - Prayer - Spiritual Direction is reckoned as sever lack in our pastoral lives. Peterson is a needed sage in the realm of modern evangelicalism.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2024
G
Verified Purchase
G. Sanders
Los Angeles, US
★★★★★ 5
A Personally Challengiing Read
Don’t expect Rosaria Butterfield to coddle sin. She acknowledges the Biblical truth that we are at war with it. It is evil. Lies are rampant with it. The Bible’s solution is to kill it, nailing it to the cross of Christ. If we don’t, it will do great and lasting harm. That is the background premise of this book. This book is for believers in Jesus Christ, especially those who identify as Evangelicals. Others may benefit by reading its pages, but I suspect that most of them will not be able to persevere through it because today’s culture is just not willing to sit through this much proclamation of Bible truth. They will react, not respond. Believers will be convicted, encouraged, and edified. Butterfield’s style is plain, but today’s culture requires her to address and to use terminology that may be challenging to many readers. It was for me. Add a level of abstraction for some challenging spiritual truths. Add the fact that she is an intellectual dealing with cultural and theological subjects. It is mostly college level reading, except for the story parts. Butterfield has credentials. A professor of English at Syracuse University, she was ten years in the Lesbian community with a mate. She was found by Christ, began to grow in Him, was discipled by faithful church women, met a wonderful man, was married to him--a Presbyterian pastor—became a mother, and began to minister to college students from a Christian perspective. She tells some of her story and the stories of others in the pages of the book. It is fascinating reading. The book is organized around the five lies that Butterfield has chosen to expose, with two to four chapters dealing with each. She acknowledges that there are others that could be exposed as well. The last one, about our culture's attitude toward modesty, was the most surprising to me. The book also has a Foreword by Kevin DeYoung, a Preface, and an Introduction. Don’t skip them. The Foreword is nothing short of a good sermon that should be shared in every church in America. In the Preface Butterfield spills the beans, revealing exactly where she stands on key topics and to whom she is addressing this volume. The Introduction is engaging and lengthy and pretty much summarizes the rest of the book. Along the way Butterfield deals with homosexuality, changing gender, male leadership in the home and in church, the bedrock importance of repentance, progressive sanctification, intersectionality, “gay Christianity” (Side A and Side B), feelings and truth, empathy and sympathy, submission of the wife, feminism, inerrancy, envy and biblical contentment, suffering, modesty and exhibitionism, and even worship. She quotes scripture, sometimes at length, and she gives copious Bible references. She also has footnotes, some of which are as interesting as the text. She names and uses or responds to contemporary authors on the topics at hand. She gives solid directions for those dealing with contemporary issues. She also has suggestions for dealing with family members beset by these matters including a question-and-answer section. Page 301. I recommend this book for all Christian leaders and for believers who want to understand contemporary challenges for the church from our modern culture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2024

recommand products