SKU: 69269084483

Human ANGPT2 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPT2 Protein, His tagProduct Specification Species Human Synonyms Angiopoietin 2, ANG 2 Accession O15123 Amino Acid Sequence Protein sequence (O15123, Asp68 Phe496, with C His tag)

Product Specification


Species Human
Synonyms Angiopoietin-2, ANG-2
Accession O15123
Amino Acid Sequence

Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight

Predicted MW: 51 kDa Observed MW: 72 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69269084483

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BlueStar
Lexington, US
★★★★★ 4
"Thus die all traitors."
Format: Hardcover
At a grand 504 pages, this big book covers the Crimson Empire series in its entirety. Containing the first, second, and third mini-series as well as Bounty Hunters: Kenix Kil, Dark Horse Extra #21-24 "Hard Currency", and Dark Horse Presents #1 "Third Time Pays for All". While some of these stories truly pale in comparison to the original series, they all still form a big story that is collected in this book. Slightly smaller than a regular TPB, this hardcover edition looks nice with a dustjacket (although mine was very off-center) but utilizes a glued binding on this thick book so you lose a bit to gutter loss. The first story in the book is the classic Crimson Empire series. The six-issue series is collected here in full with a truly timeless story by Randy Stradley and Mike Richardson. Paul Gulacy did the awesome art within the issues. The writing and art work well together with the vibration of the blades to the movie-like, choreographed 12-page fight scene between Kanos and Jax at the end. A truly epic tale with lots of action and mystery that made you feel like you were watching another Star Wars movie but condensed into six issues of a comic book! This alone is worth the purchase price but you get even more stories after this! Bounty Hunters: Kenix Kil follows the Crimson Empire in a tale following Kir Kanos after the end of the Crimson Empire series and was the third issue in the Bounty Hunters series. Kir becomes the bounty hunter Kenix Kil to move through a bounty hunter-filled planet and get what he needs and get out alive! Javier Saltares did the penciling while Randy Stradley reprised his role for the story. The story's short but tells a bit more about Kir and his journey. The drawings, while not as good as the first series, look good enough to get the story across. Crimson Empire II: Council of Blood is next directly following the first series as Kir Kanos, as Kenix Kil, continues his quest to destroy what's left of the traitorous Imperial leaders. However, the return of an old friend side-tracks his quest and brings him to an even bigger journey! The old writing team of Mike Richardson and Randy Stradley return in this story as well as the original artist Paul Gulacy. The art's great and the story, though a bit dense, works well. There isn't quite as much action this time around but the story's just as good. The Zanzibar creatures are one of the creepiest things you'll ever see in a Star Wars comic, too! Next up is the very short four-part comic entitled Hard Currency that appeared in Dark Horse Extra #21-24. The comic is written by Randy Stradley so you know the writing's done well but the art is by Isaas Buckminister Owens and is one God-awful mess. The characters are horribly out of proportion and it looks extremely cartoony. It's very, very short with only a few pages but even if you get past the art, the comic reads like a calendar with the book turned on its side. So, the whole process of reading this out of a 500+ page book is just annoying. I know they probably couldn't print it any other way but it's still inconvenient. However, what you get is a neat story wrapping up the fate of a character that has ran through the first two series and a bit more about Kir's alter ego Kenix Kil. Unlisted, the book appears to start with the third main series but actually contains an 8-page prequel comic that originally appeared in Dark Horse Presents #1 entitled The Third Time Pays for All. The writing has Randy Stradley again and, thankfully, Paul Gulacy on art duty (although his other works here were better). Once again, a short glimpse into the life of (a newly outfitted) Kenix Kil on a bounty-hunting mission while he reminisces about his past run-ins with Mirith Sinn. Mike, Randy and Paul continue their work with the Crimson Empire III: Empire Lost where Kir Kanos rejoins Mirith Sinn one last time to thwart an Imperial thug from destroying the New Republic and the New Empire in one fell swoop! Leia, Luke, Han, and Chewie appear in this tale as well as Boba Fett to round out a classic cast. The art's great, once again, and the writing, while probably my least favorite of the series, is still pretty good with an epic fight between Kir and Devian. At the end of the book, we get the Crimson Empire Handbook entries on some of the characters as well as a few more covers to gawk at. While this hardcover book looks really nice, Dark Horse still fails to make a truly great edition for this series through the book itself. The contents are great but the small size and lack of comic covers are disappointing. Sadly, that's just how Dark Horse releases their hardcovers and TPBs. But, if you're looking to read the Crimson Empire books, this is the one to get!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2013
C
Verified Purchase
Colin Tripp
Bozeman, US
★★★★★ 5
Classic Superman
Format: Kindle
Venditti captures the heart of why we love the Man of Tomorrow with plenty of exciting anthology stories. Fun little reads. Recommended for any lover of the Man of Steel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
R
Verified Purchase
Robert
Alexandria, US
★★★★★ 4
A sensasional collection for starters in the saga of Superman
Format: Kindle
Robert Venditti and Paul Pelletier deliver a solid volume of Superman Stories, aided by other talents in the art department, but this is a mostly Venditti a Pelletier gig, and many of these ar the best sigles stories of the character in a long time. A back to basics approach for rhe character, and continuity free.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2022
B
Verified Purchase
Bruce Wayne
Grantham, US
★★★★★ 5
Classic Superman is back!
Format: Paperback
This is classic Superman through and through. Venditti has an understanding of the character that will be refreshing for longtime Superman fans—especially those tired of the evil or edgy Superman tropes that have been overdone in recent years. He gets why Superman is a compelling character BECAUSE he is an overpowered boy scout—not in spite of it. This is good wholesome fun for everyone without any sort of targeted political commentary (rare in today’s comic scene). The stories are mostly self-contained with some overarching themes and some running jokes that I really enjoyed. Please give this man a chance to write Superman’s main series and turn that ship around. Venditti knows what he’s doing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 20, 2021
A
Verified Purchase
Al Jordan.
Dallas, US
★★★★★ 5
Super.
Format: Kindle
Superman : Man of Tomorrow collects stories that demonstrates how Superman and the people of Metropolis inspire each other to be better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025

recommand products