SKU: 36480881862

Human CCL20 Protein, hFc tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CCL20 Protein, hFc tagProduct Specification Species Human Synonyms C C motif chemokine 2, Beta chemokine exodus 1, CC chemokine LARC, Liver and activation regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP 3 alpha), Small inducible cytokine A20, LARC, MIP3A, SCYA20 Accession P78556 Amino Acid Sequence Protein sequence (P78556, Ala27 Met96, with N hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Expression System HEK293

Product Specification


Species Human
Synonyms C-C motif chemokine 2, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Small-inducible cytokine A20, LARC, MIP3A, SCYA20
Accession P78556
Amino Acid Sequence

Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Expression System HEK293
Molecular Weight

Predicted MW: 35 kDa Observed MW: 35 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3α), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36480881862

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
The best no sugar natural fiber
Even if you have no problems with your dietary system, fiber is an excellent way to protect your lower GI system. I use the no sugar version as I want the fiber, but I want the extra carbs in the regular version. Regular no sugar is fine, and has no problems with taste. Every so often, I treat myself to this better stevia sweetened version. I don’t take either one 3 times a day, as recommended, but I do take it every morning. If you like the regular sugar free version, give this a try. Since I take it every day, I do like occasionally switching to the better version. Read the labels of your fiber supplement products, if you take them. Very few give you the amount of fiber that this does, and you control exactly how much fiber you want. If you read up on the benefits of adding to your daily fiber intake, you will wonder why you haven’t been adding this to your daily healthy supplements This is a very effective way to protect yourself, and most other products don’t come close!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2021
N
Verified Purchase
Nijjargirl
San Leandro, US
★★★★★ 5
Great product for bloat and regularity
This works! I try to take a big tablespoon in the morning and if Im feeling bloated maybe one at night. Within a day or two, it helps you get regular! And it makes you go..and not loose, runny stool either. It leaves with that “empty stomach” feeling. I have this set up on auto delivery. Its a bit expensive but like that it has stevia, so am willing to pay the extra. It tastes like OJ but drink it asap or it becomes thick and slime like within a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2020
S
Verified Purchase
scjr
Grantham, US
★★★★★ 5
More expensive and not as sweet as regular Metamucil, but no aspartame
I switched to the Stevia variant of Metamucil to cut down my daily intake of aspartame sweetener. The taste definitely isn’t as sweet and invariably some might not like that. I thought the same initially, but after a few dosages of the less-sweet Stevia Meta I’m now use to the taste. For me—less aspartame in my diet is more important than having an overly sweet product. The product functions the same way and is very effective in keeping you regular and the additional fiber in your diet is very important. Try it, but keep in mind it may take some time getting use to the less sweet flavor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2019
J
Verified Purchase
JAD
Omaha, US
★★★★★ 5
Incredible…
This stuff is incredible. I used to take a psyllium supplement semi regularly but would always stop after a week or so of getting tired of it. This stevia version of Metamucil is better than any fiber I’ve ever taken. Tastes great, dissolves immediately, works incredibly well, and doesn’t get old or repetitive like other versions. Flavorful but not overly sweet. It’s amazing what it does to your poops too. Unbelievable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2022
R
Verified Purchase
Robert F
Massapequa, US
★★★★★ 4
Not real sweet, but no sugar
I have been taking Metamucil with real sugar regularly for 20+ years. I became concerned about the amount of sugar I was consuming daily and cannot tolerate aspartame. So, I jumped to buy this when I saw Stevia. I quickly noticed that this version is not sweet. It’s sort of bitter. Also, the texture is different due to not having sugar granules mixed in. It also converts to a gel like texture quicker. I later noticed you use less of this product per serving than the one with sugar (read the label!). I have found the best way to take this is to very quickly (seconds) consume the serving after adding water. Don’t wait too long. I down it like taking a shot out of a shot glass followed quickly by a glass of water. After a while, I got used to the flavor. Overall, I am pleased I am consuming much less sugar and really don’t notice the change anymore.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2022

recommand products