SKU: 13293550241

EphA7 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphA7 His Tag Protein, HumanProduct Specification Species Human Antigen EphA7 Synonyms EHK 3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein Accession Q15375 1 Amino Acid Sequence Gln28 Val555, with C terminal 10*His

Product Specification


Species Human
Antigen EphA7
Synonyms EHK-3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein
Accession Q15375-1
Amino Acid Sequence

Gln28-Val555, with C-terminal 10*His QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 68-75kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Xiangyi Chen, Dechen Yu, Haiyu Zhou, Xiaobo Zhang, Yicun Hu, Ruihao Zhang, Xidan Gao, Maoqiang lin, Taowen Guo & Kun Zhang Clinical and Translational Oncology volume 24, pages1274-1289 (2022).

Background

Ephrin-a receptor 7, also known as EphA7, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. At the same time, in recent years, more and more studies have shown that EphA7 protein is abnormally expressed in a variety of malignant tumors, involved in tumor occurrence and metastasis, and correlated with patient prognosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13293550241

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
HumbleAmphibian
Pawtucket, US
★★★★★ 5
Works just as well as the official parts, for less
Color: Omni S1 Pro 17P
Been going through these for about two years now across multiple replacements and they perform just as well as the official Eufy parts. Main brush, side brushes, filters, dust bags, mop — all fit correctly and do the job without any issues. Honestly if you’ve got a Eufy Omni S1 Pro, just buy these instead. No reason to pay extra for the official kit when these hold up just as well over time. No complaints
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
T
Verified Purchase
Tytan Olmstead
West Palm Beach, US
★★★★★ 5
Amazing replacement parts
Color: Omni S1 Pro 17P
Works just like original parts, and fits my s1 perfectly. Mops are super easy to change and clean
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2025
F
Verified Purchase
Foreverfit
Birmingham, US
★★★★★ 5
fits my S1 perfectly
Color: Omni S1 Pro 17P
works well with my vaccum
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025
L
Verified Purchase
lilas bouskila
Chelsea, US
★★★★★ 3
Not a good fit with the eufy
Color: Omni S1 Pro 17P
It’s a good value for all these pieces, but the dust bag does not fit well with the Juvi. I haven’t tried the other piece pieces. I will return it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
V
Verified Purchase
Vinny
Charlottesville, US
★★★★★ 4
Mostly fine replacement parts
Color: Omni S1 Pro 17P
I can't get either of the rolling mops to snap into place no matter what i do, might have to tack on something so they stay in place. The main brush was a fine fit, but the side brushes seems more flat than the stock ones and it makes some weird noise now, they did snap on though. Filter was fine though and I haven't tried a dust bag yet, still good value even if I can't get the mops to fit for me!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2025

recommand products