SKU: 12786581044

ST6/CD82 His Tag Protein, Human

Sale price$356.40 Regular price$396.00
Save 10%

Pay in installments of $99.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ST6/CD82 His Tag Protein, HumanProduct Specification Species Human Antigen ST6 CD82 Synonyms KAI1, SAR2, TSPAN27 Accession P27701 1 Amino Acid Sequence Gly111 Leu228, with C terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen ST6/CD82
Synonyms KAI1, SAR2, TSPAN27
Accession P27701-1
Amino Acid Sequence

Gly111-Leu228, with C-terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6.

Background

KAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12786581044

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Fan
Phoenix, US
★★★★★ 5
Highly recommend.
Style: Sport, Size: 12in
Love this. Dog sitting for a dog that loves to chase balls but my shoulder doesn’t like throwing them. Got this yesterday and it’s perfect. Real arm/shoulder saver. Seems sturdy and I was concerned that a standard tennis ball would not work. We tend to lose balls when walking because this lab insists on carrying the ball in its mouth. They work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
D
Verified Purchase
Dobelvr
Natrona Heights, US
★★★★★ 5
These are awesome and I couldn't play ball with my Dobermans without it!
Style: Sport, Size: 12in
I LOVE Chuckit ball launchers. We've been using for a around 17 years and we've only had to replace one. We have 2 active, energetic Dobermans and I throw like a girl and there is now way I can throw a ball very far. With the Chuckit, I can throw more than 80 feet! My dogs need a lot of exercise and using this ball thrower allows me to make that happen. Bonus is I dont have to pick up a snobbery ball :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
E
Verified Purchase
Eddie R.
Louisville, US
★★★★★ 4
Not a long shot
Style: Sport, Size: 12in
This item is much smaller than I thought it would be . The ball is full sized . But the thrower is very small. Works okay. But does not throw the ball very far . It’s okay for me . My dogs are small. My yard is too . But , this is not going to throw balls really far . Like the long ones do Thsnks Eddie
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
Perfect addition
Style: Sport, Size: 12in
This is item that I needed but didnt know it. Its been great for saving my sholder anad my dog loved the longer chase to get the ball. Easy to use and lots of fun
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Jaclyn P.
Lowell, US
★★★★★ 5
I would buy this twice!
Style: Sport, Size: 12in
This Chuckit! Dog Ball Launcher 12M Sport is the perfect product for the dog park! It makes games of fetch so much easier and more fun — the long handle gives great reach, so I can launch balls super far without even bending over, and our dog goes absolutely wild chasing them. It’s comfortable to hold, works smoothly with 2.5" dog balls, and really saves your arm and back if you’re doing a lot of throwing. The design is sturdy and reliable, so we can play for longer without worrying about it snapping or wearing out. If you spend time at the dog park or love playing fetch, this launcher turns a regular game into something even better — our pup gets twice the exercise and we get to enjoy every minute of playtime!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026

recommand products