SKU: 895112236

Cholera Toxin B subunit (CTB)

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cholera Toxin B subunit (CTB)Product Specification Synonyms CHOLERA TOXIN B SUBUNITCTB Cholera Toxin B subunitCTxBCholeragenoid Accession P01556 Amino Acid Sequence MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN Expression System E. coli Molecular Weight 11. 8kDa(Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <0. 2EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris, 100mM

Product Specification


Synonyms CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid
Accession P01556
Amino Acid Sequence

MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Expression System E.coli
Molecular Weight

11.8kDa(Reducing)

Purity >95% by SDS-PAGE & RP-HPLC
Endotoxin <0.2EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH9.0
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Cholera toxin (CTB)belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 895112236

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
steve
Pawtucket, US
★★★★★ 4
Good product but smell doesn't last
Cleans and rinses great, does not dry out your skin. Smell great, not as strong as the Italian Bergamot, nor does it last after showering. Once you dry off, smell pretty much gone. Bergamot lasts a little better
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
I
Verified Purchase
Imani S
Chelsea, US
★★★★★ 5
Beyond my expectations…
Scent: Incredible 10/10. The entire shower smells like a spa afterwards. Woody notes, vanilla scent is deliciously heavy and warm, and even one pump delivers a punch of fresh vanilla scent to your entire body. I’m a woman who is in love with heavy earthy scents and this is it! P.S it also matches well with scents like vanilla, cocoa butter, chocolate, or even delicious “smore” scents! I pair it with vanilla and cocoa butter scented deodorant, vanilla perfume, or vanilla body lotion and it works amazing! Longevity: Lasts the entire day if I’m staying home just relaxing, not working out or sweating very much. I could shower in the early morning and by the time my head hits the pillow I still smell it faintly! If I’m out and about it still lasts hours I’d estimate around 6-8 hours before the scent fades! If I shower at 6am, come home at 5pm-6pm after work I still smell fresh! (I always shower 2x a day but you don’t even need to with this! Value for Money/Size: Oh absolutely! I think I bought this soap two weeks ago? Used it nearly every day, and you can’t even tell! One pump is enough, two pumps MAX per shower per day. I decided to lavish myself by buying this soap, because it’s a bit more pricey. But it’s actually saving me more money, at this rate I’ll be buying another one of these every 3 months! So that’s…4 times a year? 5 max? That’s incredible. I’ll probably stick with Cremo for life honestly. And I’m a woman!💕🎀
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
L
Verified Purchase
Light-Zone
Louisville, US
★★★★★ 5
High Quality and Smells Great!
This is so far superior to the standard soaps that you buy off the shelf in a supermarket. It creates a truly luxurious lather and smells fantastic without being obnoxious or perfume.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
E
Verified Purchase
Ebin buy :D
Bozeman, US
★★★★★ 5
Best vanilla body wash I've seen
Proper vanilla scent with a kick, without the vomit inducing synthetic aftertaste
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
C
Verified Purchase
Christopher McMakin
Grantham, US
★★★★★ 5
A major upgrade from standard drugstore brands—sophisticated scent & better lather.
I have been a long-time user of standard body washes (think Old Spice, Axe, or Dove Men), but I kept seeing hype about Cremo and decided to see if it was worth the slightly higher price tag. After using the 32oz Spice & Black Vanilla for a week, I can confidently say this is a massive upgrade for your shower routine. ​Here is how it stacks up against the typical grocery store brands: ​1. The Scent is on another level: Most cheaper washes smell like generic "Sport" or "Ocean" cologne. This scent is much more complex and earthy. ​Top Notes: It starts with a sharp, spicy kick (that's the cardamom). ​Finish: It settles into a smooth, warm vanilla and tobacco scent. It smells more like a high-end department store fragrance than a soap. ​Staying Power: The scent actually lingers. If you shower in the morning, you will still catch subtle hints of the warm spices for a few hours, which pairs really well with woody colognes. ​2. Performance & Feel: The consistency is thicker than what I'm used to. You only need one solid pump to get a rich lather with a loofah. Crucially, it rinses clean without leaving that "squeaky" residue that dries out your skin, but it also doesn't leave a slick oily film like some ultra-moisturizing washes do. It hits a perfect balance. ​3. Value: The 32oz bottle is substantial. Because the gel is concentrated, I expect this bottle to last 3-4 months easily, making the cost per ounce very reasonable compared to buying smaller bottles of cheaper stuff every few weeks. ​Pros: ​Sophisticated, "grown-up" scent profile. ​High-quality pump (sturdy, doesn't clog). ​Non-drying formula is great for colder months. ​Cons: ​Potency: The scent is strong. If you are sensitive to fragrance or prefer unscented products, this might be overwhelming. The bathroom will smell like it for a good 20 minutes after you're done (which I enjoy, but keep it in mind). ​Verdict: This bridges the gap between basic hygiene and luxury grooming. If you are tired of smelling like "Blue Sport" and want something warmer and more refined for the fall/winter, this is absolutely worth the switch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2025

recommand products