SKU: 46430987681

Mouse IL-17A Protein, His tag

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-17A Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 17A, IL 17, IL 17A, Cytotoxic T lymphocyte associated antigen 8 (CTLA 8), Il17a, Ctla8, Il17 Accession Q62386 Amino Acid Sequence Protein sequence (Q62386, Thr22 Ala158, with C His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Expression System HEK293 Molecular Weight Predicted MW: 17. 1 kDa Observed

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46430987681

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Cuba, US
★★★★★ 5
Filter quality and value
Style: CF11809 Classic
2nd time to purchase this item over a 5 year period. The filter has a rigid frame making last much longer than other paper filters. Perfect fit and worth the cost. Great job filtering cabin and neutralizing odors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
D
Verified Purchase
Donte Davis
Belleville, US
★★★★★ 5
Simple Upgrade That Makes a Real Difference
Style: CF10140 Classic
Installed the Zezut cabin filter in my 2005 Infiniti G35 and noticed the difference immediately. The air inside the car felt fresher and cleaner right away — no more stale air circulating through the vents. The HEPA backing is a big deal, knowing it's actually filtering out dust, pollen, and particles rather than just being a basic filter gives you real peace of mind. The quality feels solid and well made. Installation was super easy, took just a few minutes with no tools needed. For the price this is one of those simple maintenance upgrades that's absolutely worth doing. Your lungs will thank you. Great price and affordable, top choice for replacement in my opinion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Verified Purchase
Andy...
Lake Worth, US
★★★★★ 4
Good filter.
Great filter works well .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
J
Verified Purchase
Joe
Lexington, US
★★★★★ 5
Efficient long lasting. Great Value
Style: CF10735 Classic
These filters (my second one) has lasted me over two years with a little maintenance in between, (removing from time to time to vacuum and shake out the bigger debris.) They do a great job of keeping the cabin air really clean and fresh. 1) Over designed and built (Good thing) installed without effort. 2) Fit and finish is perfect for my 2016 Genesis G80 3) Carbon filter works well but after about six months it no longer absorbs orders, This is excepted especially when I have not swapped it out for over two years. 4) Great value and honestly I should be replacing these cabin filters out ever six months for efficiency and order control. Note: When I decided to replace it the filter held up structurally as the day I installed it. The charcoal beads where all intact as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
R
Verified Purchase
RadcoCorp.
West Palm Beach, US
★★★★★ 5
Better than OEM, AC is so fresh now!
Style: CF10374 Classic, Style: CF10374 Classic
YEEEEEEAHHHHH! This went straight from the mailman's hand to my 2010 Tacoma. -Fits better than OEM and Replacements! -AC smells so fresh now! -Easy installation without any complications. -Has a foam gasket around the filter that makes it fit like a glove, thight and secure! -Very Well Made and quality materials. Won't be returning this one, will actually buy it for the rest of my cars! ⭐️⭐️⭐️⭐️⭐️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products