SKU: 95341218727

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95341218727

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeff walker
Whiting, US
★★★★★ 5
Great price
Pattern Name: Full Ears, Size: 8 Count
Great price, my bloodhound loves them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
E
Verified Purchase
E. L. F.
Port Orchard, US
★★★★★ 5
Dogs Love
Pattern Name: Full Ears, Size: 25 Count (Pack of 1)
Dogs love. No more to say.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
T
Verified Purchase
Tabs
West Palm Beach, US
★★★★★ 5
Love this set!!!
Size: Medium (2.5"), Style: Fetch Pack 1
I was trying to figure out which of the many different balls this company offers, and I was getting frustrated but then i was SOOOO happy to see they had multiple sets that had multiple of the different balls they offer!! I bought this set and the other set they offer, but this one was my favorite and I think my dogs too! The orange ball works great and bounces just high enough that it doesn’t clear our patio wall, but enough for him to go and jump up to retrieve. But the glow in the dark ball is his favorite! Both me and my pomsky were blown away how we brought the glow in the dark ball outside just as the sun was going down, and when we brought it back inside it was BRIGHT AND GLOWY!!! Even with the sun going down and not much light left!! He loves to play with it in the house after it’s all glowy from the sun. Sometimes we even glow it up under a light inside the house if it’s dark outside, and he will play with it outside in the dark haha he loves it!!! And I think it’s pretty cool too!! All of the balls this company overs are VERY durable! We realized early on that we cannot give our dog regular tennis balls cuz his favorite thing to do is tear the outside fabric off!! So we were trying to figure out what company has the best balls for dogs so they can’t sit there and try to pry them apart, and we found this company!! We have already bought from them about 3 times and all of their balls are durable and bounce how they say they will bounce!! They have the super bouncers and the glow in the dark one and the one with angles that will bounce in different directions and the ones you can throw REALLYY far! Overall, all the balls from this company are very durable, bounce really good, and keep my dog occupied without allowing him to sit there and tear it apart!!! Which i love cuz I do not like when he stops playing with us to sit there and try to take off the fabric, cuz then he could swallow it! So always buy the balls from this company!!! They are the best and most durable!!!! Also plenty soft for your dogs mouth so they can chew on it a bit and it won’t hurt their teeth/gums!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2024
J
Verified Purchase
Jen C
Belleville, US
★★★★★ 5
Good sturdy balls
Size: Medium (2.5"), Style: Fetch Pack 2
My dogs love balls! Unfortunately, they tend to chew them up very quickly. My Belgium Malinois chews on this all the time, and it has held up pretty well. Good option for chewers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
B
Verified Purchase
Baibhav Bhattarai
San Leandro, US
★★★★★ 5
Fetch Perfection
Size: Medium (2.5"), Style: Fetch Pack 2
If you’re anything like me, fetch is the ultimate game with your furry companion. The Chuckit! Dog Fetch Ball Medley has taken our playtime to the next level with its variety and durability. This 3-pack of medium-sized, ultra-rugged balls is perfect for endless games of fetch without worrying about wear and tear. I love how each ball has a unique texture and color, keeping my dog engaged and excited every time. The medium size is just right for energetic dogs, allowing for long throws and big leaps. Plus, the rugged design means these balls can withstand even the most enthusiastic chewers and rough play sessions, making them a great investment for active pets. However, the vibrant colors can sometimes make them easy to lose in green grass or sandy beaches, but a good game of hide-and-seek with your dog is a small price to pay for such fantastic fetch balls. Additionally, while they’re durable, no ball is completely indestructible, so occasional replacements might be necessary for the most aggressive players. Overall, the Chuckit! Dog Fetch Ball Medley is a must-have for any dog owner looking to enhance their playtime. They’re fun, durable, and keep both you and your dog entertained for hours. A solid 5-star rating for their quality and variety, with a tiny star lost to their occasionally elusive colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024

recommand products