SKU: 23566562288

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23566562288

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Felicia
Carnegie, US
★★★★★ 5
Cute jeans
Size: 12, Color: Washed Blue, Size: 12, Color: Washed Blue
Bought these jeans for my daughter and they fit great! The material is thick, which is nice even in warm weather. They look just like the photo and have a great length to them. Very comfortable and stretchy . She loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
T
Verified Purchase
Teri PD
New York, US
★★★★★ 5
FANTASTIC FIT
Size: 16 Plus, Color: Washed Blue
I'm a 4'7" , 65 year old woman. Due to abdominal issues I needed jeans that give that extra something on the waist. I've tried on just about every brand of jeans ranging in size from adult/junior 6 to 12. If they fit on the legs the waist was huge. If they fit on the waist the legs and butt had enough room for me and a friend. I was resigned to wearing yoga pants and leggings with big shirts. My son mentioned that he loved the Amazon basics men's dress slacks, so I figured why not. First I looked at women's and juniors, and I knew from the measurements that I was still stuck. Then I remembered that about 15 years ago I'd buy girls pants (I was a size 12 in kids at the time) Looking at the sizes I knew a 12 was way too small, then I saw the 16 plus. With hesitation I bought them. Well glory be miss Agnes, THEY FIT. Comfortable, real jeans again. Sure, I have to take them up about 6 inches, but that's fine, not a problem. I'm just so happy to have real jeans again !!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2023
D
Verified Purchase
DeRobinson
Boise, US
★★★★★ 5
Who doesn't love a unicorn?
Size: 2T, Color: Pink/Unicorn
Cute set but runs a bit big in my opinion for a size 2T. My grandbaby is tall for her age (22 months), but the pants were really long and loose on her, granted she's not chunky, so factor that in. Overall, it's a nice set and the material is soft (especially the pants) and seems like it would keep the little ones warm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
J
Verified Purchase
Jennuh G.
Dallas, US
★★★★★ 5
Cute outfit for everyday.
Size: 2T, Color: Pink/Unicorn
Exactly as pictured. Good quality, not too thin but also not too thick. True to size and looks like it will keep my baby warm when she’s inside. Good price on sale! Was a steal!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2025
K
Verified Purchase
K.B
Cuba, US
★★★★★ 5
High Quality
Size: X-Small, Color: Pink/Unicorn
High print quality, and vivid colors. Got exactly what I expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025

recommand products