SKU: 94205070077

Human GM-CSF, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GM-CSF, His tagProduct Specification Species Human Synonyms Granulocyte macrophage colony stimulating factor, Colony stimulating factor (CSF), Molgramostin, Sargramostim Accession P04141 Amino Acid Sequence Protein sequence(P04141, Ala18 Glu144, with C 10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 1kDa

Product Specification


Species Human
Synonyms Granulocyte-macrophage colony-stimulating factor, Colony-stimulating factor (CSF), Molgramostin, Sargramostim
Accession P04141
Amino Acid Sequence

Protein sequence(P04141, Ala18-Glu144, with C-10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.1kDa Actual:17-30kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. Unlike granulocyte colony-stimulating factor, which specifically promotes neutrophil proliferation and maturation, GM-CSF affects more cell types, especially macrophages and eosinophils. It is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94205070077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Emily Heater
Phoenix, US
★★★★★ 5
Awesome product!!!
Size: 3 Panel-102"W, Color: Beige, Size: 3 Panel-102"W, Color: Beige
This thing is really awesome. I actually bought 2 of them and made myself a nice little enclosure to keep out any peeping Toms while I’m trying to work on my summer tan. What I was looking for is FULL privacy and this DEFINITELY provides that. Fabric is completely opaque, you cannot see anything through it which is exactly what I needed. Another huge bonus is the strips of fabric to cover the spaces in between the panels, giving TRUE privacy. This is a really well-made product, great design, great structure, and pretty easy to put together overall. The only downside is that with strong gusts of wind, it wants to tip over so as you can see I secured the bottom feet with a couple bricks to make it stable and that did the trick. But to me that is a minor inconvenience given all its other great aspects. So many other privacy dividers were still see-through… totally defeating the purpose. But this one is absolutely full privacy and PERFECT for what I needed it for!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2024
M
Verified Purchase
MJL06
Port Orchard, US
★★★★★ 5
Nice temporary divider or screen
Fairly easy to assemble and ensures privacy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
E
Verified Purchase
extrasupervery
Boise, US
★★★★★ 1
Broke within an hour of assembly.
Size: 6 Panel-120"W, Color: Beige
This is of horrible quality. Within an hour of building, the feet support were broken on both ends, where they spin in place & do not stay straight to hold the divider up. Pieces of the plastic on the feet were broken simply from assembling the product. The covers for the metal poles were the only reason I bought this divider instead of other similar products, however those only cover one side of the metal poles so they are still visible from the other side. Two of these covers were also torn & not useable within an hour of assembly, one was already partially ripped on arrival & the other one was ripped simply during assembly of the product. I do not recommend this item & would have returned if I was still in the return window. I missed the return window because the product was bought during the holidays & I didn’t have time to mess with the return. I have not been able to use this product even once, the broken feet which do not stay in place make it very unstable & dangerous.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
A
Verified Purchase
alena
Draper, US
★★★★★ 5
WOULD BUY AGAIN.
EASY TO PUT TOGETHER. WORKS EXATCLY AS i NEEDED. I USED ONLY 3 PANELS.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
T
Verified Purchase
T
Houston, US
★★★★★ 5
Nice quality, looks brand new even with daily use! Worth it!
Size: 6 Panel, Color: White
I got the Rose Home 6 panel room divider folding privacy screen and I LOVE it. I use it every day - extending it out to both block the sun, provide a backdrop for my plant wall, use as a backdrop for zoom calls, create privacy at night in front of the big windows and clear doors, and make impromptu study privacy walls in the office. This 6-panel has been the GOAT! Even though the screen is made of a woven paper material, it is still going strong despite daily use and has NOT broken anywhere. The frame is taller than other folding screens I've purchased and this one is also heavier and sturdy. Additionally the hinges fold open in BOTH directions (some screens only fold open in 1 direction like a Z). I use the folding screens indoors, but they have no issue with the AC or fans for wind resistance indoors. Sometimes I use them to hide storage or junk in the corner and make the room look neater. I also have a different brand that is the same material but has 8 panels and I love them both. I got 2 others that were made from synthetic canvas webbing belt/leash fabric and those break so fast - I just had to throw 1 away. This one is worth the money, even after daily use, it looks brand new!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026

recommand products