SKU: 80180577849

IL-3 Rα/CD123 His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-3 Rα/CD123 His Tag Protein, MouseProduct Specification Species Mouse Accession P26952 1 Amino Acid Sequence Ser17 Lys331, with C terminal 8*His SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKGGGSHHHHHHHH Expression

Product Specification


Species Mouse
Accession P26952-1
Amino Acid Sequence Ser17-Lys331, with C-terminal 8*His SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 45-65kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin-3 receptor α (IL-3Rα) is the α subunit of the ligand-specific IL-3R and initiates intracellular signaling in response to IL-3. The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. IL-3 amplifies proinflammatory signaling and cytokine storm in murine sepsis models. In vitro, IL-3 stimulation promoted IL-3Rα proteasomal degradation dependent on RNFT2 (RING finger transmembrane-domain containing protein 2, also TMEM118), and we identified IL-3Rα lysine 357 as a ubiquitin acceptor site. Researches identify RNFT2 as a negative regulator of IL-3Rα and show a potential role for the RNFT2/IL-3Rα/IL-3 axis in regulating innate immune responses in the lung.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80180577849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
ARS
Dallas, US
★★★★★ 5
Quality & Comfort with Fully Adjustable Support
Team Name: Eden, Size: Queen, Color: Classic
I used to buy pricey, handmade, 100% down pillows—until I learned about the cruelty behind down production. I stopped using down entirely: pillows, comforters, jackets, everything. Then began the long search for something that could at least come close to the comfort of down, I tried Tempur and countless others, but nothing came close. As a side sleeper, I need a pillow that’s high, SOFT, supportive, conforming, and huggable. After wasting money on at least five different pillows, I finally tried the Coop Home Goods Eden Pillow because of its adjustability. The cover is kind of thick, soft, and well‑made (I use a nice cotton pillow cover over it). The filling is soft and high quality. You can customize the height and firmness however you like. It even comes with plenty of extra fill. To my surprise, the shredded foam doesn’t make the pillow clumpy—something every other similar pillow I tried struggled with. The surface stays smooth and soft, and it’s been a total game‑changer. It’s a keeper! I’ve had mine for almost four years now and only needed to add more filling once, about 8–10 months ago. Toss it in the dryer on low with a couple of tennis balls, and it fluffs up like new. And the icing on the cake: outstanding customer service. I highly recommend this pillow and will definitely buy it again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
A
Verified Purchase
Andrew L. Carpenter
Whiting, US
★★★★★ 3
Nothing like the original Eden, don’t buy the name
Team Name: Eden Cool+, Size: King, Color: Classic
I’ve had the original Coop Eden for 5+ years and it has been a great pillow, very comfortable, soft but supportive but when I purchased a new mattress I wanted to refresh my pillow and saw the Eden Cool+ and wanted to give it a try. I figured it could only be better than the original Eden…but it is not. While the outer cover is noticeably cooler to the touch, it is not soft like the Eden. Also, this cool material mostly gets negated if you use a pillow case anyway. The shaped fill material I would also say is “lumpier” for lack of a better word than the shredded material in the original. The combination of the harder, less supple outer casing and the lumpy material just aren’t a good combination. I will say it does sleep slightly cooler than the original Eden but not enough for the sacrifice in comfort. I would absolutely consider going back to the original Eden.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
C
Verified Purchase
Chris B
Chelsea, US
★★★★★ 5
Unmatched Pillow with Unmatched Customer Service!!! 5 STAR ALL AROUND
Team Name: Eden Cool+, Size: King, Color: Classic
## A Dream Come True (and Customer Service to Match!) From the moment I first laid my head on the Coop Eden Cool+ pillow, I knew I'd found something special. It's truly a game-changer for hot sleepers like me. The "Cool+" technology isn't just a gimmick; it actually works to keep my head and neck comfortably cool throughout the night, leading to the most refreshing sleep I've had in years. The adjustable fill is brilliant, allowing me to customize the loft perfectly for my sleep style, which means no more waking up with neck pain. The support is fantastic – it cradles my head without feeling too firm, and it holds its shape beautifully. However, what truly elevates my experience to a full five stars, beyond the exceptional product itself, is the **dedicated and outstanding customer service**. I had a minor issue with my initial pillow (a rare manufacturing defect, which can happen with any product). I reached out to Coop Home Goods, and their response was nothing short of phenomenal. They were incredibly prompt, empathetic, and went above and beyond to resolve the issue swiftly and completely. They genuinely cared about my satisfaction and ensured I was left with a perfect product. It's rare to find a company that not only produces a superior product but also stands behind it with such integrity and genuine concern for their customers. The Coop Eden Cool+ pillow is an investment in your sleep, and knowing that you're backed by such an incredible customer service team makes it an even easier decision. Highly, highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
L
Verified Purchase
ladyesmiles
Boise, US
★★★★★ 5
Very comfortable and supportive.
I really am quite amazed with these pillows. As with most people who suffer from neck and back pain it's almost impossible to find a comfortable pillow. One year I must have went through 20 sets trying to find the right pillow. I received these and they were flat in the package. All you have to do is take them out and fluff them up a little bit with your hand and let them sit overnight. What's really nice about these is they are soft and cushy but they have a support that does not flatten when you lay down. Of note when I was looking for pillows, I noticed that these had a price of $110 which was crossed out and then a huge discount. Looking at the item now I see that the top price for the king size is $42. So I'm going to say that $110 was a comparison of what a good pillow might cost. I do want you to know that a set of pillows that I had been using were $200 a piece and these are very comparable to that. I am not having any issues overheating with these as I have a very nice cover on them. They are washable. My neck feels totally better. So all in all I am quite impressed with these pillows and very surprised that the first set I ordered is working perfectly for me. I am a side sleeper and needed my neck to be straight and these do the job with a nice little cushion on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
K
Verified Purchase
Kathleen Regan
Carnegie, US
★★★★★ 5
The BEST pillow you will ever sleep on!!
The BEST pillow you will ever purchase!! Right amount of firmness and support yet soft!! Quite the sleep enhancer!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products