SKU: 68507151008

LRP10 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LRP10 His Tag Protein, HumanProduct Specification Species Human Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7Z4F1 Amino Acid Sequence His17 Lys440, with C terminal 10*His

Product Specification


Species Human
Synonyms LRP10, LRP9, MST087, MSTP087
Accession Q7Z4F1
Amino Acid Sequence His17-Lys440, with C-terminal 10*His HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRKGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 56-66kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Manini A. et al. (2021) Screening of LRP10 mutations in Parkinson's disease patients from Italy. Parkinsonism Relat Disord. 89: 17-21.

Background

Parkinson's disease (PD) is a neurodegenerative disorder characterized by resting tremor, bradykinesia, muscle rigidity, and abnormal gait. Parkinson's disease (PD) belongs to a family of neurodegenerative diseases characterized by alpha-synuclein accumulation in neurons. LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. The low-density lipoprotein receptor-related protein 10 (LRP10) was recently shown to be a causal gene for PD, and different ethnic cohorts have distinct frequencies and spectrum of LRP10 variants.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68507151008

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nicole barbay
Boise, US
★★★★★ 5
Water bottle
Color: Shy Marshmallow, Size: 24 Ounces
My son had to have this water bottle and at first I was like what's all the hype about but I know now bc it literally the best water bottle, it super easy to clean, its versatile, it keeps your drink cold all day, the lid is amazing bc there's no leakage at all and you can use a straw or the drinking part for your mouth, great value for the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
H
Verified Purchase
Heather Watson
Pawtucket, US
★★★★★ 5
great water bottle, doesn't leak
Color: Camo Cool, Size: 24 Ounces
Headline: Finally, a Water Bottle That Lives Up to the Hype!⭐⭐⭐⭐⭐"I’ve tried almost every popular water bottle brand out there, and the Owala FreeSip is genuinely in a league of its own. The 2-in-1 spout is a game-changer—I love being able to sip upright through the straw or tilt it back to chug. It makes drinking water so much easier.It’s completely leakproof when locked, which I’ve tested in my gym bag multiple times. Plus, the cover keeps the mouthpiece sanitary. It keeps my water ice-cold for over 24 hours, even sitting in a hot car. And let's talk about the colors—they are so fun and vibrant. I got the 24oz, and it fits perfectly in my cup holder. If you’re on the fence, just buy it!"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
M
Verified Purchase
Maylauri
Houston, US
★★★★★ 4
Great Water Bottle but failed after one year.
Color: Foggy Tide, Size: 32 Ounces
I purchased this Owala water bottle a little over a year ago and it was in my top favorites. The flip-up lid is a great feature, and I like that you can use it with or without the straw. It’s completely leak-proof, comfortable to carry, and has held up well with daily use. My only complaint had been that it doesn’t fit in most standard cup holders. But after about a year, I did notice that it stopped keeping my water cold as long as it used to, and the ice began melting much faster. I reached out to Owala customer service but unfortunately never received a response. Even with that issue, I still prefer the lid design over brands like Yeti or RTIC, so I would consider purchasing another Owala in the future. If you value a convenient, leak-proof lid design, it’s definitely worth considering. I just sincerely hope the insulation lasts longer on the next one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
K
Verified Purchase
Kristen Tryon
New York, US
★★★★★ 5
The BEST water bottle on the market!
Color: Denim, Size: 32 Ounces
I am in love with this water bottle! I take it everywhere with me, and I love that it has a built-in straw. The color is perfect as well. It motivates me to get my water intake in, and it helps me meet my fitness goals. It is easily washed in the dishwasher, and I don't have to worry about it breaking. It keeps the temperature of my water perfect- whether I add ice or not. It is sturdy but not too heavy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
M
Verified Purchase
Mira M
Lexington, US
★★★★★ 5
Deeply Compassionate, Clear and Truly Helpful
Format: Hardcover
Thank you Dr. Ramani for your clear and nuanced book on narcissism. You "get every aspect of it" and your deep and compassionate understanding shines throughout and is a healing balm for my soul. You truly see and know this territory and we are grateful for your understanding and depth of compassion. You have made such an important contribution to the healing of this world and to me personally. Thank you from the bottom of my heart. I would like to also say that I've watched dozens of your videos on YouTube, also incredibly enlightening and helpful, and having the book was still a huge "add" for me. The way you laid everything out... it's just such a relief. This book is seared into my soul in the best, most compassionate, enpowering way. My view on forgiveness is different than yours. Forgiveness sets my own heart free and I don't pair it with second chances or staying in toxic relationships. I damaged my health and wellbeing through misplaced empathy and compassion... trying to overly help or fix the other when they didn't have the interest or capacity. No more. I have reclaimed my physical and mental health. Narcissists have not yet found their hearts and my wish for them is that one day far away, at some point in their next lives, they will.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026

recommand products