SKU: 7370085817

Human B7-H6, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human B7-H6, His tagProduct Specification Species Human Synonyms B7 homolog 6 (B7 H6), B7H6 Accession Q68D85 Amino Acid Sequence Protein sequence (Q68D85, Asp25 Ser262, with C 10*His) DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms B7 homolog 6 (B7-H6), B7H6
Accession Q68D85
Amino Acid Sequence

Protein sequence (Q68D85, Asp25-Ser262, with C-10*His) DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 28.4 kDa Observed MW: 35-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

B7-H6 is a glycosylated member of the B7 family of immune co-stimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors. The expression of NKp30 ligands on tumor cells correlates with tumor cell sensitivity to NKp30‑dependent cell lysis. B7-H6 is expressed in several tumor cell lines, both in vitro and in vivo, including esophageal squamous cell carcinoma, oral squamous cell carcinoma and breast cancer. but remains undetected in healthy cells thus far, and is therefore an excellent tumor marker.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 7370085817

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristin
Waukegan, US
★★★★★ 5
Love and Beware
This is a fabulous product but be aware that if you wash you face vigorously and splash ANY oil on your walls it will stain. I love it but hate the spots that I sometimes get. I have tried a little diluted dish soap but it doesn’t really help.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
S
Verified Purchase
Santos
Boise, US
★★★★★ 4
Whoa- I can’t believe this!
I wanted to try this product for a very specific purpose, I have been looking at facial cleansing wipes to use occasionally at bedtime instead of stripping my face by doing a full wash with cleanser and water. I rarely wear makeup, I spend my energy on finding the best skincare products for my skin and sunscreen. So at bedtime usually, I’m just taking off sunscreen and the day’s grime, or if I didn’t go out, the day’s moisturizing products. I tried several brands of moist facial cleansing wipes, and they left behind a greasy film and my face still feels like it needs a full wash. I would never want to skip properly cleansing my skin, and I usually do a full routine while I shower, but it would be nice to be able to occasionally do something quicker and more convenient without sacrificing on quality. I was hoping this product might cleanse well without needing to be rinsed or breaking me out on occasions where I want something quick and convenient, or maybe am travelling and need a basic routine. Wow, this product is not only perfect for that, it actually makes my skin soft and clean, you’d never know I skipped my regular cleansing and just used this Bioderma product with a cotton pad before my nighttime moisturizers/serum. It completely takes off the day’s water resistant facial sunscreen and any sweat or grime and leaves my skin very clean, soft, not dry, and it feels like there is no residue whatsoever. I also don’t break out or get clogged pores, it is just a clean, soft texture. One cotton pad with product is all takes for my entire face to look and feel just as clean as if I had used my regular products (a cleansing balm followed by a foaming cleanser and lots of rinsing with water). I have used this micellar water quite a bit since receiving it, and have not broken out or had clogged pores from “cutting corners” so to speak. And it cleanses very well. I can’t believe how well it cleanses without needing to be rinsed, without irritating my skin, without clogging pores or causing breakouts, and is suitable to use and then put on my serum and nighttime moisturizer. I’ve even used it the next morning to remove the nighttime moisturizers and then put on my SPF. I worried that I was going to cause my skin not to look as good if I didn’t properly wash and rinse with water but this product is so amazing. I have not yet used it to see how well it removes makeup since I rarely wear any, but just for skincare and cleansing without a full wash with regular water, it is so amazing. Not going to sugarcoat it, this is me wanting a convenient routine when I travel but this is also me being lazy on nights when I’m very tired or mornings when I am in a hurry. I consider this one of my few holy grail skincare products. I have picked up a smaller size for travel. I will keep this on hand always. I’m not even looking at moist wipes anymore. (This product is more gentle and leaves no residue as compared to a dermatologist recommended brand of face wipes). I’m most surprised that it cleans my face so thoroughly and that not rinsing does not cause any irritation or breakouts. Just wow. Totally worth the price. I was going to try other brands but this product has been so good there is no need to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
T
Verified Purchase
Taimi Childs
Charlottesville, US
★★★★★ 5
A little goes a long way!
I'm almost 50 years old and have dry and super sensitive skin. I've struggled to find for years a gentle moisturizer, but effective on my fine lines as well. Omg this works! This gives my skin a beautiful non-oily glow, no negative reactions or breakouts, and leaves my skin so incredibly soft with elasticity. Within minutes it dries (or skin soaks it up) wonderfully, it's not sticky. I'm very pleased with this product, I will be purchasing it again, I hope this product remains the same, and stays on the market. I LOVE this product! I also have no need for my expensive moisturizer anymore, that was quite frankly not as nice as this. Keeps my skin moisturized and soft for 24 hours, fully tested this. I do use an eye cream, but only after I've used this over my entire face and neck after washing. Amazing product, no scent, awesome value for the money. Highly recommend!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 20, 2025
M
Verified Purchase
Monica
Los Angeles, US
★★★★★ 5
Unique Texture, Amazing Results — Now One of My Favorites!
This serum definitely has a texture similar to snail mucin, so it took me a few tries to get used to — but I’m so glad I stuck with it because the results are incredible. Once it absorbs, my skin feels deeply hydrated, smoother, and so much more plump. The rice and ceramide formula really strengthens the skin barrier, and I’ve noticed my complexion looking brighter and healthier overall. It layers beautifully under moisturizer and doesn’t leave any sticky residue once it settles in. If you’re looking for a hydrating, brightening serum and don’t mind a unique texture, this one is absolutely worth it. It grew on me fast and is now a staple in my routine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
B
Verified Purchase
Beautifulkrãzy
Massapequa, US
★★★★★ 5
Great products
Helps with skin irritation does not leave a crazy residue. It is effective and it's an easy application! so the valuable for your money . They could definitely charge a little less, though. But all around great products by ANUA
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026

recommand products