SKU: 69786951811

CD7 His Tag Protein, Cynomolgus

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession XP_005585387. 1 Amino Acid Sequence Ala26 Pro180, with C terminal 8*His AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 40kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Cynomolgus
Antigen CD7
Synonyms CD7, GP40, TP41, LEU-9, Tp40
Accession XP_005585387.1
Amino Acid Sequence

Ala26-Pro180, with C-terminal 8*His

AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-40kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016.

Background

CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69786951811

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yuli
Boise, US
★★★★★ 5
I love this milk frother, a must have for coffee lovers!
Color: Silver
I absolutely love this Bonsenkitchen milk frother! It creates the perfect foam in seconds and my coffee has never tasted so good. The rechargeable feature is so convenient and I love that it comes with a stand to keep it organized on my counter. It is easy to use, easy to clean and works perfectly every single time. If you love coffee at home this frother is a game changer, it makes you feel like you are at a coffee shop without spending a fortune. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Sheila65
Port Orchard, US
★★★★★ 5
Does the job!
Color: Silver
Great frother. Love that it's rechargeable. 3 speeds, double frothing ring. This one is way better than my last, battery operated one. A lot of people giving are negative reviews or deductin stars because they think you have to cycle through the speeds to turn it off - they're wrong. You just hold the button for a couple of seconds and it turns off. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
J
Verified Purchase
Julia
Houston, US
★★★★★ 5
Great frother
Color: Silver
Excellent product. Works well and is easy to use. The charge lasts a long time. Worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
D
Verified Purchase
Dr Berry
Birmingham, US
★★★★★ 4
Stand was my favorite part, hated how close off and higher speed is
Color: Silver
Well the first lesson is dont hit the power button to turn off, as it goes to 2nd speed and slings your drink everywhere. Im not happy with the stability of the brother, had better, as free with coffees. Positive is, it has a stand, it does have 3 speeds, just never needed the other two speeds, and if you dont hold power button long enough to turn off, it goes into higher speed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
W
Verified Purchase
William
Waukegan, US
★★★★★ 5
Bonsenkitchen Rechargeable Milk Frother witThe
Color: Silver
I drink a specialty coffee that uses a Keurig to dispense it when it comes out pot and it mixes well I use this to mix my collagen, my coffee and some mushrooms to help keep me active and it works perfectly. I’d recommend this to anybody that is mixing their coffee with others things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products