SKU: 63108981436

Mouse CXCL10/IP-10/CRG-2 Protein

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CXCL10/IP-10/CRG-2 ProteinProduct Specification Species Mouse Synonyms C X C motif chemokine 10, 10 kDa interferon gamma induced protein (Gamma IP10; IP 10), C7, Interferon gamma induced protein CRG 2, Small inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10 Accession P17515 Amino Acid Sequence Protein sequence (P17515, Ile22 Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP Expression System HEK293 Molecular Weight Predicted MW: 8. 7 kDa

Product Specification


Species Mouse
Synonyms C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10; IP-10), C7, Interferon-gamma induced protein CRG-2, Small-inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10
Accession P17515
Amino Acid Sequence

Protein sequence (P17515, Ile22-Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Expression System HEK293
Molecular Weight Predicted MW: 8.7 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C-X-C motif chemokine 10 is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN-γ. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL9, CXCL10 and CXCL11 have proven to be valid biomarkers for the development of heart failure and left ventricular dysfunction, suggesting an underlining pathophysiological relation between levels of these chemokines and the development of adverse cardiac remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63108981436

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M. Heiss
Grantham, US
★★★★★ 4
I'll admit I was skeptical
Ordinarily, the follow-on books are kind of flat. The Elizabeth George "After God's Own Heart" books seemed this way, although the first one, "A Woman After God's Own Heart" was excellent. I was expecting the same sort of flatness from this book. I found a lot to apply in the original Love Languages book, and I'm still sneaking it into my marriage. It's one thing to tell your Quality-Time husband that you are a TOUCH wife, and a whole different thing to gently convince him to touch touch touch touch touch touch. It has brought me to a whole new level of positive reinforcement. So I figured this one for kids would be a couple of hundred pages of telling parents that kids need *every* love language. And indeed, there was some of that. But the book was full of clues for how to recognize your child's love language, how it may change over time, and how to communicate. The book offered a lot. I thought the chapters on conflict were very worthwhile, and even on how to discipline in the different love languages. My kids are so different that I needed all the pointers I could get. And surprise -- thinking about love languages across generations has helped me communicate better with my parents, too -- off to a good start, anyway. I read this 6 months ago. My eldest started talking more, to me and to other people, NOTICEABLY more, and it's bringing me some relief from one of my biggest parenting worries -- how remote this child has been. That has been the biggest and most immediate change in our family recently, and I can trace it to this book. I would recommend you read the first Love Languages book first, and then this one to think specifically about your kids. Oh, and for moms, definitely read A Woman After God's Own Heart by Elizabeth George. It's family-enhancing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2008
S
Verified Purchase
Seeker
Louisville, US
★★★★★ 5
You Love Your Child, But Does Your Child Feel Loved?
I rarely read a book from cover to cover twice, but when I was given the opportunity to receive a free copy of the 2012 Edition of The 5 Love Languages of Children by Gary Chapman and Ross Campbell for review, I was eager to do so, particularly since my daughter was so young the first time I read it that I could not determine her love language at the time. To be honest, even with the Love Language Mystery Game to help determine a child's love language, I still cannot be sure of my daughter's even though she is old enough that I should be able to do so. There is nothing wrong with the concepts described in the book, I think it is just that my daughter seems pretty balanced as she receives all five gratefully and gives all five as well, which I believe suggests that her father and I successfully have been keeping her "love tank" full most of the time. The book proposes that as loving as parents may try to be, a child may believe his parents love him, but may not feel loved because the parents are not speaking in the child's love language. While one child may be happy with a gift when the father comes home from a business trip, another child may not feel loved by getting a gift because his love language is quality time. This book helps parents to determine which of the five love languages--physical touch, words of affirmation, quality time, gifts, or acts of service--a child appreciates and needs the most as well as how the parent can help the child to feel loved. It also stresses that every child needs all five, but one will be predominate. I highly recommend this book for all parents, particularly those who are having difficulties with their children, but it is beneficial even to those who think they have happy, loving children. Probably just as important as understanding how to speak in the child's love language is how to discipline with love without causing damage to the parent-child relationship by using a type of punishment that empties the emotional tank; a chapter is devoted to this subject. If you are like me and have a 1997 Edition, let me explain the main differences I noticed between the two books, besides the change in the cover. The earlier edition often referred to keeping the emotional tank full would help to avoid drug use and teenage promiscuity, which was not in the latest edition. In the 2012 Edition, there were some updated statistics and reference to a book Battle Hymn of the Tiger Mother by Amy Chua that was published in January 2011. Some of the names in the stories had been changed to more popular names at the time of the rewrite. The most notable addition was the list of suggestions to speak the child's love language at the end of each corresponding chapter. Otherwise, there were only minor editing changes here and there. I did think that the hand print in the heart on the cover of the first edition was a better depiction than the green rubber boots with flowers, but that is a minor point. I received this book for free from Moody Publishers in exchange for my honest review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 24, 2012
F
Verified Purchase
Frequent Customer
Lowell, US
★★★★★ 5
I love this book! Helped me with the kids, my parents and my boyfriend.
I bought this book in preparation for becoming a stepmother. Knowing the kids involved had experience some difficulties in their relationship with their biological mother I wanted to make sure I could bring something positive to the table. We have already utilize some of the lessons in this book to ensure that the kids are happy and healthy in the decisions that by boyfriend was making with them on his own. We have also used information provided in this book to help his ex-wife better understand what the right decisions for the kids are to best meet their needs. I have actually sent multiple copies of this book to family members who I feel would benefit from its information. I frequently talk about the love languages of children as it relates to friends family and romantic relationships as well as co-worker or boss employee relationships. I think at this point everyone I know is sick of hearing about this book. I purchased the love languages of teenagers book to prepare for the next stage in the kids lives. I also plan to purchase the love languages for couples book so that my boyfriend and I can learn to communicate even better since we got some helpful information out of this book unexpectedly. I highly recommend reading this book. As a child who did not feel loved by her parents I think it would be important for every parent to read this and have an understanding of the different needs that each child has so that they can show the love that they have in a way that their child can understand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2018
T
Verified Purchase
594 Tuff
Boise, US
★★★★★ 5
Favorite treat of all time for our Maltese pup.
Pattern Name: Lollipop, Size: 0.53 Ounce (Pack of 4)
These are my Maltese dog’s favorite treat. I don’t know if it is the whole combination of shape, taster, tendon location, or that they are from a Turkey, but they are an absolute winner when we have them. Since they are quite expensive, we only get them on occasion. If they were less expensive, even by 10%, I would justify regular purchases of them to myself. I highly recommend them for any size, breed, or reason. They are an exceptionally wonderful treat for my pup. I think I have just found the reason for ordering another order of these Turkey Tendon lollipops for my best friend. Especially since he eats them quite quickly, even though he is only four pounds. And they seem to be quite digestible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Verified Purchase
J. Barry
Natrona Heights, US
★★★★★ 5
Perfect treat for my Dolcé!
Pattern Name: Bone, Size: 0.53 Ounce (Pack of 4)
My 14 pound Maltipoo LOVES these. It keeps her occupied for a good 30 minutes. Be sure to get the bone-shaped ones because little dogs will choke on the lollipop-shaped ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026

recommand products