SKU: 61564828387

Human ST2, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ST2, His tagProduct Specification Species Human Synonyms sST2, Interleukin 1 receptor like 1 Accession Q01638 Amino Acid Sequence Protein sequence(Q01638, Lys19 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms sST2, Interleukin-1 receptor-like 1
Accession Q01638
Amino Acid Sequence

Protein sequence(Q01638, Lys19-Ser328, with C-10*His) KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:36.6kDa Actual:55-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The ST2 cardiac biomarker (also known as soluble interleukin 1 receptor-like 1) is a protein biomarker of cardiac stress encoded by the IL1RL1 gene. ST2 signals the presence and severity of adverse cardiac remodeling and tissue fibrosis, which occurs in response to myocardial infarction, acute coronary syndrome, or worsening heart failure. ST2 provides prognostic information that is independent of other cardiac biomarkers such as BNP, NT-proBNP, highly sensitive troponin, GDF-15, and galectin-3. One study indicated that discrimination is independent of age, body mass index, history of heart failure, anemia and impaired kidney function or sex.sST2(Soluble ST2) is a biomarker for risk stratification in patients with heart failure (HF) and prognostic assessment. Compared with BNP and NT-proBNP, ST2 is not affected by age, factors such as BMI and renal insufficiency.Different with so many other heart markers, the level of ST2 varies rapidly with the patient's condition. This means that ST2 can help clinicians respond faster. The increase of sST2 level (> 35ng/ml) was highly correlated with the severity of heart failure which can be used to predict readmission and mortality.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61564828387

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jean
Port Orchard, US
★★★★★ 5
Perfect Prom Suit
Size: Small, Color: Dark Black, Size: Small, Color: Dark Black
This suit was perfect for prom. The fit was clean, the material looked high quality, and the texture gave it a unique look. Definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
C
Verified Purchase
Craig L.
Belleville, US
★★★★★ 5
Award winning tuxedo!
Size: Large, Color: Baby Pink, Size: Large, Color: Baby Pink
Love this tuxedo suit! I’ve worn it a few times - to two different weddings and an Academy Awards viewing party, where I even won for best dressed. I get so many comments on it. The jacket and vest fit perfectly, however the pants are long and I had to hem them, but “stitch witchery” tape worked fine. The pants are also a little “stiff” - not a smooth fabric. But for occasional wear, it’s fine! The bow tie was sold separately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
T
Verified Purchase
Terry
Chelsea, US
★★★★★ 5
Slim fit
Size: Large, Color: Brown
I recently purchased the brown slim-fit suit and am very impressed! For reference, I’m 6’2” and 222 lbs, and while I usually wear a size large, I went with an XL based on the fit advice and it was the perfect choice. This suit does run a bit small, so ordering a size up is definitely the way to go. The slim fit is flattering and modern without being restrictive, and the rich brown color adds a unique and stylish touch to any occasion. The material feels high-quality, and the overall craftsmanship is excellent. If you're looking for a sharp, well-fitting suit, this one is a fantastic option—just be mindful of the sizing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2025
D
Verified Purchase
DiamondKut
Lexington, US
★★★★★ 5
Good Decision !
Size: Large, Color: Dark Black, Size: Large, Color: Dark Black
Upon receiving the suit we were definitely skeptical because certain materials don't match the pictures. But Baby when we say this one came and showed up. It was great material , not cheap feeling if you get what Im saying. The pants, jacket and vest all came as it said it would. Nothing was missing! It came pressed and very wrinkle free so it was taking care of prior to shipping out. We got a Large for my son because of course he wanted a slimmer fit. But it did work out. He had enough room to comfortably be able to move. And for it truly was a steal for how much it costed. This literally felt like it was suppose to cost a few hundred , but it was so affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
F
Verified Purchase
fireblue
Lake Worth, US
★★★★★ 5
"Showstopper Suit That Turned Heads All Night!”
Size: Medium, Color: Violet Purple, Size: Medium, Color: Violet Purple
I absolutely love this suit. We bought it specifically to match my son's girlfriend's prom dress, and it could not have been a more perfect choice. After she picked out her gown, I spent the entire Sunday searching for a suit that would complement it, and when I saw this one, I knew it was the one. The colors, the pattern, the style—it all came together perfectly. When prom day came, my son looked so confident, handsome, and proud. He and his date looked stunning together, like they coordinated their outfits down to the smallest detail. You could tell they were a couple just by the way they complemented each other. He received nonstop compliments, not only at the prom send-off but even later that night when we went to Texas Roadhouse. People were turning their heads and praising the look. It was truly a moment. This was hands down one of the best purchases I have ever made on Amazon. I do not usually write reviews, but this suit deserves the recognition. It was sleek, bold, well-fitted, and absolutely top tier. If you're considering this suit, do it. It is a total showstopper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2025

recommand products