SKU: 2891188935

Human IgG2 Fc

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 FcProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), no tag)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), no tag) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.7kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag N/A
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2891188935

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
asbelair
Waukegan, US
★★★★★ 5
just buy them
Size: 300 Count (Pack of 1)
Look.. They are paper plates. Are they thin? yes; use two of them, they are cheap enough. If you want "sturdy" to hold your spaghetti or thanksgiving dinner, then use a regular plate and get out of the review section. We use for pizza, sandwiches, hotdogs normal paper plates foods to avoid washing dishes 17times day. If my kids use 25 in one day. so what; each plate cost less than a penny. Bought 300ct in Feb 2025. It's April 2025 and I'm getting ready to place a 2nd order.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2025
B
Verified Purchase
Big_Julz
West Palm Beach, US
★★★★★ 3
Low Quality, High Quantity, But Definitely Overpriced
Size: 500 Count (Pack of 1), Size: 500 Count (Pack of 1)
When did low quality paper plates start costing so much? Yes, you get 500, but these are very thin and I tend to use 2 or 3 at a time, especially when they stick and I don’t want to deal with ripping them apart. These are just ok. Nothing quality about these plates but they do what I need when I use those paper plate holders to keep them supported.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
R
Verified Purchase
Richard D. Ribble
Louisville, US
★★★★★ 5
Made in the USA out of safe components.
Size: 500 Count (Pack of 1)
These are excellent plates and made in the USA. There are no substances used in manufacturing that we need to worry about. We’re so glad to have access to these!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
B
Verified Purchase
Beverly B Cook
Belleville, US
★★★★★ 5
Paper plates
Size: 200 Count (Pack of 1)
Great for crafts
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
L
Verified Purchase
Lee
Pawtucket, US
★★★★★ 5
NICE for soups!
Style: 34 Ounces, Size: 34 Count
We try to keep these in the house. They are REALLY nicely sized and work great for soups. They are AWESOME for soups and the only disposable plates I feel comfy using for large stews and such. Makes cleaning easy because I don't HAVE TO CLEAN! They are a bit more expensive than otherd disposable plates, but they are worth it. Pretty heavy duty plates that are thick and great for heavier foods. <3
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products