SKU: 57057589808

LILRB2/CD85d/ILT4 His Tag Protein, Cynomolgus

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB2/CD85d/ILT4 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession BAE87348. 1 Amino Acid Sequence Gly24 Leu448, with C terminal 8*His

Product Specification


Species Cynomolgus
Accession BAE87348.1
Amino Acid Sequence Gly24-Leu448, with C-terminal 8*His GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENLGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 63-70kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57057589808

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Celeste A
Whiting, US
★★★★★ 5
Go dog toys are the best!
Size: Large, Color: Dinos Frills (Pink)
These are the only stuffed toys I buy for my Pittie because they are so well made. Even when she unstuffs them, she plays with them forever!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
A
Verified Purchase
a customer
Belleville, US
★★★★★ 5
My dog loves these toys.
Size: Mini, Color: Gator (Pink)
Not a huge toy, nor is my dog. But we have lots of goDog toys. Practically indestructible and my dog likes to carry these in his mouth and bring them onto the foot of our bed. Brilliant colors and good squeaker but my dog is afraid of the squeak. Fair value for cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
U
Verified Purchase
University Doc
Boise, US
★★★★★ 5
Our XL dogs love them. Highly recommend it!
Size: Mini, Color: Gator (Pink)
Our XL dogs love this! Highly recommend them! Highly recommend. Not for aggressive chewers but our big dogs don't destroy their toys. They cherish them. Great for play and cuddling. Not to loud either. Very cute.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
V
Verified Purchase
Valhalla49
West Palm Beach, US
★★★★★ 5
When they said strong...
...they weren't kidding. Our pup would chew through everything she could get her sharks teeth into. Like my arms. Nothing lasted as long as a week or maybe two. But she has had Dino for months now. She loves him. He is the go to toy for when she wants to play tug. The material used to make this toy is every bit as strong as the seller claims. I will definitely buy from them again. And I will not wait for this one to rip. I may be waiting a long time. If your pup likes to tear stuff apart, feel safe in buying this toy, UPDATE: 2/9/2023 Dino finally succumbed to the torture. His back ripped open and despite trying to repair him with ordinary thread he couldn't withstand the pressure, His stuffing was removed and spread all over the living room. Completely emptied he is still a good toy. Strong enough to withstand the forceful play of tug-o-war. Only thing I would suggest is to use something stronger when closing his back. The rest of him is great. I will be replacing him soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2023
R
Verified Purchase
Rachel
Belleville, US
★★★★★ 4
Not so tough
Size: Mini, Color: Gator (Pink)
I bought this because I dog sit. The dog chews up every. Single. Toy. So I bought it since it was cheap and it can be in the “chunk” (the dog’s name) toy box. It is not durable at all. He tore it up just as fast as a cheaply made toy. Chunk LOVES it! He would not stop playing with it. He loves the squeakers, it is a perfect size for him to throw it up in the air and chase it, and he loved ripping the legs off. It is good for my husband and I because there is little to no fluff. However, it is the perfect size to drop behind the couch and not be able to get. So once he drops it behind the couch, he won’t get it until morning. Now for my dog’s rating. My dog loves this toy too. He is much more gentle with toys (he has $5 Walmart toys we bought him back in 2020 in perfect condition that he plays with them every day). Before Chunk came over for the weekend, my dog Ted played with this. Ted is a larger small dog and chunk is a smaller small dog. And it is still the perfect size for both dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026

recommand products