SKU: 8560121456

NRAS, Avi&His Tag Protein

Sale price$348.30 Regular price$387.00
Save 10%

Pay in installments of $96.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NRAS, Avi&His Tag ProteinProduct Specification Species Human Synonyms ALPS4, CMNS, N ras, NCMS, NRAS1, NS6 Accession P01111 Amino Acid Sequence M1 N172 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN Expression System E. coli Molecular Weight 23. 6 kDa Purity >90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag Avi Tag, His Tag Physical

Product Specification


Species Human
Synonyms ALPS4, CMNS, N-ras, NCMS, NRAS1, NS6
Accession P01111
Amino Acid Sequence

M1-N172

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN

Expression System E.coli
Molecular Weight 23.6 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8560121456

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
John Grey
Port Orchard, US
★★★★★ 5
As described
Color: Black
Light weight, easy to put together and you can disconnect the ends and just roll the whole thing nice and tight for quick out of the way storage. Pretty sturdy, doesn't fall over if you bump into it, you could use it outside but if there's a lot of light you can see through a tiny bit if you're really close but I only tested this indoors so not sure about patio types
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
A
Verified Purchase
Amyth4
Pawtucket, US
★★★★★ 2
Flimsy - choose something else
Color: Black
Very flimsy and barely stands up… better options out there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
A
Amazon Customer
Pawtucket, US
★★★★★ 5
Versatile Room Divider With Easy Assembly and Strong Coverage
Size: 3 Panel 12FT W
I picked up this Siebwin 3-panel folding room divider mainly for privacy and room separation, and overall it works very well. Assembly is very straightforward, and the divider can be set up, taken apart, and stored without much effort. The fabric quality feels good, and the frame construction is stronger and more stable than expected. The support tubes especially feel well built and help keep the divider standing securely. One feature I really liked is the flexibility of the design. The panels can be used together as a complete divider or separated depending on the setup and available space. That makes it much more versatile for different room layouts or temporary privacy needs. The coverage is also very good, and the size matches the manufacturer’s description accurately. The fabric blocks light and background visibility well enough to provide solid privacy without feeling overly heavy. The wider feet also help improve stability compared to thinner folding dividers. Another positive detail is that everything arrived complete with no missing parts or damaged pieces, which made assembly much easier and faster. Compared to cheaper privacy screens, this one feels more durable and easier to customize depending on the situation. In terms of value for the money, it feels like a very practical and worthwhile purchase considering the size, flexibility, and build quality. Overall, a versatile and well-built room divider with easy assembly, strong privacy coverage, stable construction, complete included parts, flexible panel configuration, and excellent everyday functionality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
F
Fred
Cuba, US
★★★★★ 5
Stable, flexible in deployment configuration, creates true privacy and looks great.
Size: 3 Panel 12FT W
This is the second room divider panel I have installed, and there are several features about this one that I like much better than my older one. The fact that there are no gaps and that the material is thicker means you get more privacy or more hiding power, if you wish. My older divider has vertical spaces between each of the panels and the panels are half as wide as the Siebwin panels, so there are many vertical spaces. The Siebwin divider really creates privacy. Another feature that I really appreciate is that the legs are wider and stand off from the floor. On my older one the legs are flat and they're rather awkward to adjust because they create more drag on the floor. The feet on the older one also loosen if you turn them counter clockwise, so adjustments of configuration that require the feet to be moved are more complex. The older divider also must be deployed in a zig-zag fashion because he feet are not as wide, but this new one can be deployed and stable in a straight, an "N" shape or an arc. They are both the same length, but because the older one must be use in a zig-zag deployment it doesn't reach to the length of the new one. The Siebwin divider definitely costs more at $103.48, but it sports several features and advantages over the other brand, so it does a better job and is worth the extra cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
C
Computer
Bozeman, US
★★★★★ 4
Easy to assemble, does the job, material is shiny nylon and shows creases, minor defects, sloppy
Size: 3 Panel 12FT W, Size: 3 Panel 12FT W
The Siebwin room divider is a good idea, and for the price, it mostly delivers on the intended functionality. I ordered the 12 foot, 3-panel version mainly to hide an unfinished basement storage area that had become an eyesore. It works well for that purpose and gives the space a cleaner appearance without spending the kind of money that more decorative dividers or custom partitions cost. If you need something temporary, portable, or mainly functional, this is a viable option. There are a few limitations that became obvious during setup and use. The first thing I noticed was that the weld quality on some of the metal poles is fairly sloppy. Once the cover is installed, you do not really see it, but up close, it does not look especially refined or professional. The blackout material also is not a matte canvas style fabric as I expected. It has more of a shiny nylon appearance, and the creases are fairly visible. Being that it’s more of a nylon, I’d be hesitant to try steaming it to remove the creases. However, the creases do not matter if you are using it in a basement, dorm, or shared room, but for photography, video work, or a professional office setting, the appearance could be disappointing. The fabric is thick enough, though. It blocks visibility well enough, but strong light behind it still shows through to some extent, nothing deal-breaking. Also, my fabric appeared to be slightly defective. The hook and loop strip on one of the bottom sections was off-center and couldn't be totally attached because it was lined up with one of the legs. I originally hoped to use this as a video backdrop, but I will probably end up replacing the fabric with a proper green screen or canvas material while continuing to use the frame itself. For now, it does a good job of covering my basement junk. Assembly was actually easier than I expected and took roughly 15 to 20 minutes. The longer vertical poles are tethered together similarly to tent poles, which made setup straightforward and fairly intuitive. The shorter horizontal pieces slide and snap together to the top and bottom of the vertical assembly. After each section is assembled, the divider panels connect together with metal plates and two knurled screws (at the top and bottom), so no tools are really required. A few screws were difficult to start because paint had gotten into the threads, but once they caught, they tightened down normally. The feet install with similar knurled fasteners and help keep the divider reasonably stable. One thing to watch for during setup is the fabric orientation. There is one arrow indicator in the middle of the fabric to indicate up. However, if you need another indicator, the smaller hook and loop strip goes on the bottom while the longer strip goes on top. I realized mine was upside down right before finishing and had to redo it. I wasn't difficult to redo, despite the defect in mine. The overall design is practical and easy to move around. I do like that the panels can fold and bend into different shapes depending on the space. The widened feet help stability, although when trying to stretch the fabric tight, I noticed the poles sometimes wanted to overlap slightly at the joints. Tightening everything helped somewhat, but it still happened occasionally. The divider feels adequate for normal indoor use, though I would not expect premium durability or luxury-level fit and finish at this price point. The entire device can also be easily disabled and stored in a tote if you need it completely out of the way. It comes with assembly instructions, but even if you didn’t have them, it’s easy to build without them (save a mistake or two). In terms of value, I think the Siebwin divider mostly matches its price. Around $100 gets you a large freestanding partition with decent usability and easy assembly, but there are compromises in materials, appearance, and refinement. The defects are also off-putting, but hopefully you won't have them. Higher-end room dividers can easily cost two or three times more, so some of the tradeoffs are expected. I also noticed cheaper alternatives online, but based on the quality here, I suspect those would probably have even more issues. For practical home use, temporary privacy, hiding storage areas, or separating shared spaces, this is a good option as long as expectations stay realistic.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products