SKU: 45246562839

MUC-1(116-173) Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MUC-1(116-173) Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15 3 Accession P15941 Amino Acid Sequence Ser116 Gly173, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15-3
Accession P15941
Amino Acid Sequence Ser116-Gly173, with C-terminal Human IgG1 Fc SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 36-42kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brayman M. et al. (2004) MUC1: a multifunctional cell surface component of reproductive tissue epithelia. Reprod Biol Endocrinol 2: 4.

2、Schroeder J A. et al. (2001) Transgenic MUC1 interacts with epidermal growth factor receptor and correlates with mitogen-activated protein kinase activation in the mouse mammary gland. J Biol Chem. 276(16): 13057-64.

3、Li Y. et al. (2001) The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin. J Biol Chem. 276(38): 35239-42.

Background

Mucin 1, cell surface-associated (MUC1) or polymorphic epithelial mucin (PEM) is a membrane-bound protein that is a member of the mucin family. Mucins are heavily glycosylated proteins that give the mucosa viscous gel-forming properties, and contribute to the structural organization of secretory epithelia. The mucosa serves as a physical barrier to protect the epithelium from harsh environments such as low pH and microbial infections. Cell surface associated mucins, such as Mucin-1 (Muc-1), are important components of the mucosal barrier that exist at the interface of the apical surface between secreted mucins and the cell surface. In addition to the mucus-type functions of its extracellular mucin domain, Muc-1 is a transmembrane protein with a cytoplasmic tail that is a known target of multiple kinases that has been shown to participate in normal and oncogenic signaling.Muc-1 is overexpressed and aberrantly glycosylated in many cancers, where it has been documented to play an important role in inflammation and tumor progression.Muc-1 is also expressed on many non-epithelial cell types including leukocytes, where its function is less well characterized. It has been documented that Muc-1 controls inflammation resulting from Helicobacter pylori infection by suppressing activation of the NLRP3 inflammasome. Knockout of Muc-1 also results in aberrant expansion of myeloid derived suppressor cells from the bone marrow.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45246562839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sarah Mason
Dallas, US
★★★★★ 5
If you were looking for a sign to buy this, here it is
Color: A) Small 2.5" Ball
If you are looking for a ball that can stand up next to a heavy, aggressive chewer.. this is a good choice. Our Pitbull literally destroyed any and every toy that she gets with the exception of one kind of kong ball. She tore through the kong Frisbees, any kind of squeaker toy, and the wobble wag giggle ball (she usually always ends up destroying these but it takes a few weeks. Today she beat her record and had her brand new ball destroyed within the first 30 minutes of us taking it out of the box). But, this ball she has not been able to destroy. I'd like to believe that the Kong ball she has and this ball are made of the same material. Because they are the only balls she can't ruin. And it's not because of a lack of trying. We have watched her sit there and chew with a side of her mouth for an hour or more, trying to make some kind of indention or tear in it and it just never happened. She loves to chew this thing, chase this thing, sleep with this thing. I most certainly recommend this ball. If it is I'ah proof then it is most certainly, 100% a durable ball and worth every penny
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
Michael Campbell
Los Angeles, US
★★★★★ 5
Chew King Supreme Chew Toy
Color: B) Medium 3" Ball
So far, freaking amazing. This ball is awesome. I have a 90 lb American Bulldog. Like other reviews. Lot of " indestructible balls" lasted minimum time. Not this one. She even took it to bed with her I bought the 3 inch ball, not the 4 inch ball. The 3 inch ball works amazingly for a large Dog. Yes the 4 inch would be better. So in my opinion, either ball would be fine. As others also said. This ball keeps a active Dog busy for hours. Love to play catch. Love frozen peanut butter in it. One last thing. The price is amazing. I don't see needing to buy another, unless it is lost, because this is made to last. We couldn't be happier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
K
Verified Purchase
Kelsey
Lake Worth, US
★★★★★ 5
Malinois proof
Color: B) Medium 3" Ball
So far this has held up great. My Malinois who has destroyed nearly every ball I’ve gotten her, this one has lasted over 3 weeks without a dent, compared to some that don’t even last a day lol. Although the medium size is a little too big for her liking she still plays with it. It’s very durable and I like the middle part for engagement as well. I would recommend if you have a dog who destroys every ball possible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
T
Verified Purchase
TERRIE GILLAND
Draper, US
★★★★★ 5
Actually Durable
Color: B) Medium 3" Ball
One of the few "heavy duty" toys that my pittie hasn't destroyed after a couple of weeks. Most of them last two days. She's an absolute beast so I'm confident if she can't destroy it, few dogs can.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
C
Verified Purchase
Cody
Dallas, US
★★★★★ 1
Not for aggressive chewers!
Color: H) Infinity Ring, Color: H) Infinity Ring
Not for aggressive chewers! Done for in about two minutes. I unboxed this and tugged with my Mal for a but then let her have it. Within minutes she had chewed through it. Not worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026

recommand products