SKU: 66099131049

Biotinylated Siglec-15 Fc&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated Siglec-15 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD33 antigen like 3, SIGLEC 15, CD33L3, sialic acid binding Ig like lectin 15, Siglec15 Accession Q6ZMC9 1 Amino Acid Sequence Phe20 Thr263, with C terminal human IgG1 Fc&Avi tag

Product Specification


Species Human
Synonyms CD33 antigen-like 3, SIGLEC-15, CD33L3, sialic acid-binding Ig-like lectin 15, Siglec15
Accession Q6ZMC9-1
Amino Acid Sequence

Phe20-Thr263, with C-terminal human IgG1 Fc&Avi tag FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

57-65kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Wang J. et al. (2019) Siglec-15 as an immune suppressor and potential target for normalization cancer immunotherapy, Nature Medicine. 25: 656-666.

Background

Siglec-15 is a critical immune suppressor with broad upregulation on various cancer types and a potential target for cancer immunotherapy. Siglec-15 has unique molecular features compared with many other known checkpoint inhibitory ligands. It shows prominent expression on macrophages and cancer cells and a mutually exclusive expression with PD-L1. As a new player in the cancer immunotherapeutic arena, Siglec-15 may represent a novel class of immune inhibitors with tumor-associated expression and divergent mechanisms of action to PD-L1, with potential implications in anti-PD-1/PD-L1-resistant patients. Siglecs are cell surface proteins that bind sialic acid. They are found primarily on the surface of immune cells and are a subset of the I-type lectins. Siglec-15 consisting of immunoglobulin (Ig)-like domains, transmembrane domain and a short cytoplasmic tail. Siglec-15 is that recognizes sialylated glycans and regulates osteoclast differentiation. Siglec-15 is a potential therapeutic target for osteoporosis and plays a conserved regulatory role in the immune system of vertebrates.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66099131049

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
tim kelly
Alexandria, US
★★★★★ 5
Amazing buy will be getting more
Size: Cooling Queen
The pillows are of amazing quality the support is great there not to big in thickness and great value for two of them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
Z
Verified Purchase
Zuleima Magana
New York, US
★★★★★ 5
Comfort
Size: Cooling Queen, Size: Cooling Queen
Súper cómodas ricas y si permanecen frías lo más cómodo de almohadas que he tenido
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
P
Verified Purchase
Patricia Banuelos
Battle Creek, US
★★★★★ 5
Two pillows—one firm, one cotton
Size: Cooling Queen, Size: Cooling Queen
Blue Ridge Home Fashions: Purchase this set of two Queen-sized cooling pillows. Featuring a reversible design with a cooling side and a cotton side, these medium-firm pillows offer a breathable, down-alternative fill. They are neither too hard nor too soft, helping to support your sleeping posture. Cool to the touch, soft, and breathable, these pillows are crafted from high-quality fabric to ensure a more comfortable and restful sleep.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
M
Verified Purchase
MJ
Boise, US
★★★★★ 5
Nicest Bed Pillow Protectors I have found!
Size: Body
I have ordered these pillow protector cases multiple times for pillows that are extra thick or lofted as these seem to be very comfortable, durable, and really protect the pillow itself! They wash up well if there is any sort of stain. Nice bed pillows can be a real investment…it’s both easier to wash these protectors with my bed linens and more sanitary overall. Thin pillow protectors either wrinkle or fail to actually protect the pillow itself from whatever…dust mites, head lice, sweat, make up, skin care, spit up….be sure to follow the instructions for laundering and drying them and they will last a long time! My experience is these protectors keep my pillows from getting lumpy or bunching up, so promote a better night’s sleep!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
T
Verified Purchase
Tim
Waukegan, US
★★★★★ 5
This is definitely not your average pillow protector!
You have to see and feel this pillow protector to understand just how good it is (photos and videos just don't do it justice). It looks and feels like some sort of fancy premium luxury pillow case, but it's a zippered pillow protector! I always thought pillow protectors were just a simple white cotton zippered pillow case in order to add another layer in addition to the pillow case, but this pillow protector from COOP Home Goods completely blows me away. I just kept going, "Omg, are you kidding me? This is just a pillow protector?! Wow!" The only negative is, the zippered opening is too small. When I tried to put my brand new COOP pillow into it (I have the pillow that has approximately 15,000 reviews), it was very difficult. This was before I removed any of the filling for customization though, which I still needed to do. I finally got around to doing that and I probably removed about 1/3rd of the filling because I'm mostly a stomach sleeper, so I'm sure the pillow protector will be much easier to put on the next time I remove it, but I'm not going to remove it until I have to wash it because I don't want to be stuck trying to put it back on again! That's how annoying it was to put on. I'm keeping it though because I'm hoping it will mean I'll never have to wash the pillowcase or especially the pillow! That'd be awesome. I recently upgraded from a MyPillow Premium and I hated washing it (it was always a mini project, so I am hoping to be completely done with that). I contacted COOP about the small opening and they said, "We do have plans to change the zipper placement on our pillow protectors, however, production has not started and we do not have a firm date to provide you with at this time." They also reminded me that the pillow can be "bent and manipulated" (their words) into the pillow protector. See next paragraph though to understand why I didn't want to handle the pillow too much, otherwise I would've just done that instinctively. There is one more negative aspect that's worth mentioning, but it's due to a personal issue (there's nothing COOP can do about it). I have rough dry skin on my hands, and the material (40% Bamboo-derived Viscose Rayon, 60% Polyester) is rather 'catchy' on my hands. If you have rough dry skin and if you've ever tried to handle something made out of silk, you know what I'm talking about; you can't enjoy the silky smooth texture. This isn't anywhere near as bad as silk, but it's just bad enough that it's worth mentioning. I think it's due to the Bamboo-derived Viscose Rayon. The pillows are the same way for me due to the pillow case. That's probably what made the pillow case so difficult to put on because I was trying to be very careful not to get my skin flakes all over everything from just "manhandling" it, which is what I should've done and then just vacuumed it clean. heh I won't use lotion though because I don't like the idea of getting lotion on everything I touch every day, and it makes my hands sweat much easier - especially in the summer. So, I prefer to just deal with clean but rough dry hands. I guess another negative thing could be that it's not possible to just buy 1 pillow protector. These are 2-packs. I only needed 1 pillow protector and I only wanted 1. I would've gladly paid $15 for just 1. So anyway, beyond that, these pillow protectors truly have that "wow!" factor. They're exactly as advertised and more (because some things are only possible to know about by experiencing them for yourself).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2018

recommand products