SKU: 39749334543

Mouse NK1.1/CD161, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse NK1.1/CD161, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1C, CD161 antigen like family member C, Lymphocyte antigen 55c (Ly 55c), NKR P1. 9, NKR P1C, Natural killer cell surface protein P1 40 (NKR P1 40), Klrb1c Accession P27814 Amino Acid Sequence Protein sequence(P27814, Gln67 Ser223, with C 10*His)

Product Specification


Species Mouse
Synonyms Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c (Ly-55c), NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40 (NKR-P1 40), Klrb1c
Accession P27814
Amino Acid Sequence

Protein sequence(P27814, Gln67-Ser223, with C-10*His) QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:19.6kDa Actual:25kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD161 is one of the earliest markers expressed during NK cell maturation from CD34+ hematopoietic stem cell precursors. Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion. CD161 is expressed early in NK cell development, where it may facilitate cross-talk of NK cell precursors with cells within the bone marrow, and is involved in CXCL8 release. Within the periphery, cross-linking of CD161 leads to an increase in IFNγ expression and inhibition of NK cell cytotoxicity. There have been various reports of modulated expression of CD161 on NK cells during viral infections. For instance, reduced CD161 expression in acute hepatitis C virus (HCV) infection predicted viral clearance, and correlated with increased liver inflammation in chronic HCV infection. Patients with chronic human immunodeficiency virus (HIV) infection have depleted CD161+ NK cells compared to healthy donors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39749334543

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jesse Bell
Battle Creek, US
★★★★★ 5
Cool mats for cool cats
Color: Green Leaf, Size: Small (20'' X 16'' X 0.3''), Number of Items: 1, Color: Green Leaf, Size: Small (20'' X 16'' X 0.3''), Number of Items: 1
Well received product for upcoming warm weather for an older indoor cat, highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
L
Verified Purchase
Lorelei Williams
Cuba, US
★★★★★ 5
It works! Kitty loves it.
Color: Pink Cat, Size: Medium (27'' X 20'' X 0.3''), Number of Items: 1
My cat loves this. It really does keep her cool. I even washed it in the washing machine and put it outside to dry - still cool to the touch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
H
Verified Purchase
H. Mecham
San Leandro, US
★★★★★ 5
Best cooling purchase for my indoor cat
Color: Green Leaf, Size: Small (20'' X 16'' X 0.3''), Number of Items: 1
I have a Maine coon and he runs very hot. I don’t have much tile in my house so I bought him this, and added it to his bed. He hasn’t left his bed since I put it in there a few hours ago. He would never be in his bed longer than 20 minutes, let alone lay in it all the way. Such a successful buy for what we needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
R
Verified Purchase
Rosa M Velez
New York, US
★★★★★ 5
So soft
Ridiculously soft and high quality! I want to sleep on it. Very inexpensive for what I got
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
K
Verified Purchase
kitty2580
Waukegan, US
★★★★★ 5
Beautiful cat bed
Color: Milky White, Size: 27"L x 20"W x 1.5"Th
My cat loves this bed. It's soft and comfy, and looks very nice. She has three different beds, but prefers this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products