SKU: 33997654293

Human Thrombomodulin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Thrombomodulin, His tagProduct Specification Species Human Synonyms TM,Fetomodulin,CD141 Accession P07204 Amino Acid Sequence Protein sequence(P07204, Ala19 Thr281, with C 10*His) APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms TM,Fetomodulin,CD141
Accession P07204
Amino Acid Sequence

Protein sequence(P07204, Ala19-Thr281, with C-10*His)
APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 29.1kDa Actual: 37kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Thrombomodulin is an endothelial-specific type I membrane receptor that binds thrombin. This binding results in the activation of protein C, which degrades clotting factors Va and VIIIa and reduces the amount of thrombin generated. TM is predominantly expressed on the endothelium, plays an important role in maintaining vascular homeostasis by regulating the coagulation system. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33997654293

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
FrequentBuyer2017
Lexington, US
★★★★★ 5
Comfortable, Colorful, Soft, Affordable.
Size: Large, Color: Ice Blue, Number of Items: 1
These T Shirts are as good as it gets especially at the price point. All cotton, very soft, very colorful. Wash well. If you don’t want them to shrink, I suggest air drying them. I had an XL one for years and pretty much ignored it. Found it again and it’s amazing to wear to bed or around the house. At These prices if you need or want a T shirt, this is the one to get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
L
Verified Purchase
Leah
Battle Creek, US
★★★★★ 5
The Perfect Tee Shirt
Size: X-Large, Color: White, Number of Items: 2
I bought one of these shirts to see if they’re as good as the customer reviews suggest. They most certainly are! They have a nice weight, a great fitting collar, and the shirts have a generous length so they stay tucked in. The sleeves are longer than normal tee shirts, which I really appreciate. These shirts are such high quality, and such an amazing bargain, that I bought four more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
J
Verified Purchase
John H. Arnold
Natrona Heights, US
★★★★★ 5
A Great T Shirt
Size: XX-Large, Color: Denim, Number of Items: 1
Take it from a T type of guy, I love these T shirts. They soften with each washing and their color holds. I also think they are extremely comfortable. My forever "go-to" shirt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
T
Verified Purchase
Teejerdude
Port Orchard, US
★★★★★ 3
Comfort Colors T-shirt sizing is inconsistent from shirt to shirt
Size: Large, Color: Denim, Number of Items: 1, Size: Large, Color: Denim, Number of Items: 1
Do a search in the reviews of these T-shirts using the word “inconsistent” and you’ll see others have similar comments to mine. With almost 27,000 reviews on these shirts, not sure if anyone will even see this review, but here we go. I have about 5 Comfort Colors T-shirts that I got in the past year; all are size Large, and they fit great in the body and neck with nice soft cotton, and they are fantastic T-shirts. I recently ruined a denim-colored Comfort Colors T-shirt using Spray-n-Wash on a couple food stains on the chest; the Spray-n-Wash faded the blue color in the treated areas. No worries, I’ll just order a replacement shirt…. I decided to order two replacement Comfort Colors T-shirts with one being blue jean-colored and the second being a denim-colored T-shirt. Both are blue with blue jean being slightly lighter blue than the denim, but I decided to order two since I like these T-shirts so much. The blue jean shirt arrived and fit great and is just like all my other large Comfort Colors shirts, and it’s a keeper. However, the denim shirt I received was too small: it was tight in the chest, the body was shorter, and the sleeves were shorter. I have attached two photos with one showing this new denim shirt on top of the shirt I ruined with Spray-n-Wash and another showing this new denim shirt on top of an orange Custom Colors shirt to show the smaller size of the new shirt. The neck-size in the new denim shirt I received was fine, but the shirt was noticeably too small in all other dimensions. I immediately ordered another denim-colored shirt hoping to get a “correct size” shirt, and the second denim shirt arrived the next day, and it was also smaller in all the dimensions exactly like the first denim shirt I had just ordered. All three of these new Comfort Colors shirts (one blue jean and two denim) and the denim shirt I ruined with Spray-n-Wash were sold and delivered by Amazon (i.e. none were third party vendors). I’m returning both of the too-small denim-colored shirts, and I’ll live without that color and enjoy my new blue jean shirt. As another point of reference, I purchased a pepper-colored Comfort Colors T-shirt from a third-party vendor on Amazon about 11-months ago in November 2024, and the neck on the pepper shirt was too large and gave the shirt a stretched-out and worn-out look even though the shirt was new. A third attached photo of the pepper shirt next to an orange Custom Colors shirt and shows the neck size difference. I messed up and didn’t return the pepper shirt within 30-days last year, but since I never wear it due to the way-too-large neck opening, it’s going to Goodwill. Ordering these shirts from Amazon as the seller has been hit or miss and doesn’t guarantee a consistent fit, and ordering shirts from a third-party seller on Amazon didn’t work out well when I did it in November 2024. So, I’m not sure what the lesson is here other than the sizing of these shirts is inconsistent; when the sizing is correct they're great, but ordering them online and getting correct sizing can be a PITA. It’s a bit of a hassle to have to take them to a UPS Store or other location to return the shirts if they don’t fit well, but at least if you order through Amazon Prime, the returns are free.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025
V
Verified Purchase
VAIMW
San Leandro, US
★★★★★ 5
The Perfect Water Shoe
Size: 6 Women/5 Men, Color: 1a-407 White
The SEEKWAY Water Shoes are an outstanding choice for anyone seeking both comfort and functionality in aquatic footwear. Designed to fit true to size, they eliminate the hassle of guessing or sizing up, ensuring a snug, reliable fit that adapts well to various foot shapes. The flexible upper material hugs your feet gently, offering a barefoot feeling without sacrificing support. Ease of wear is a highlight: the shoes slip on and off effortlessly, making them ideal for quick transitions between water and land. Whether you’re heading to the beach, preparing for a swim in the pool, or starting a kayaking adventure, you’ll appreciate how convenient and lightweight these aqua socks are. The stretchable fabric and minimal design contribute to their versatility—packing them takes up hardly any space, and they won’t weigh you down as you move. Quick-drying capabilities are another strong advantage. After wading through rivers or splashing in lakes, the shoes dry rapidly thanks to their breathable construction. This keeps your feet comfortable and reduces the risk of blisters, odor, or prolonged dampness. The materials used allow water to flow out easily, while also providing protection against rocks, shells, and other rough surfaces. Overall, the SEEKWAY Water Shoes blend comfort, true-to-size fitting, easy wearability, and fast drying to deliver a practical solution for a wide range of outdoor and aquatic activities. Whether you’re hiking near water, surfing, or simply enjoying a walk along the shoreline, these shoes give you the confidence and comfort you need for every adventure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026

recommand products