SKU: 6628397135

Human CD40, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD40, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 5, B cell surface antigen CD40, Bp50, CDw40, CD40L receptor Accession P25942 Amino Acid Sequence Protein sequence (P25942, Glu21 Arg193, with C 10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CDw40, CD40L receptor
Accession P25942
Amino Acid Sequence

Protein sequence (P25942, Glu21-Arg193, with C-10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.1 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD40 is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of CD40 and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with CD40 and serves as a mediator of the signal transduction. The interaction of CD40 and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Moreover, CD40 molecule is a potential target for cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6628397135

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Laura C.
San Leandro, US
★★★★★ 5
My dogs all time favorite treat!
My dog only likes these treats only! Goes after as soon as I open the package definitely recommend to anyone who has a picky eater for a dog and looking for something to give to them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 4
Dog loves these
One of my dog’s favorite treats! Consistency on each one varies from little to fully covered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
G
Verified Purchase
GB
Los Angeles, US
★★★★★ 5
My dogs favorite
These are my dogs favourite treats at the end of the day. I used to buy the small packages, but im so glad i just discovered the large size. He waits all day for these and he'll even sit by the drawer theyre kept in throughout the day hoping to get one. They smell like real food (not strong though) and one of these lasts him at least 20-30 minutes. My dog is insanely picky when it comes to chewing sticks so im glad hes obsessed with these. He'll first chew off the chicken wrapping around the rawhide, then eat the full rawhide afterwards followed by a huge nap. They tire him out which is perfect because hes a huge chewer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
R
Verified Purchase
Renee Sorenson
Lake Worth, US
★★★★★ 5
My dog loves these chews
My dog loves these! It gives her lots of satisfaction for chewing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
C
Verified Purchase
Charles M.
Lexington, US
★★★★★ 5
Dog loved them
Scout loves these so much better than pipe Toni for him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products