SKU: 31637793289

Human papillomavirus type 16 E7

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight Predicted MW: 11.0 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31637793289

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Honestly
Charlottesville, US
★★★★★ 4
Great product before they dry up
Great smelling product, that performs and protects and a high level. It left my car looking and smelling good with its unique scent and formula. I usually keep these inside my glove box since they’re so compact I can easily get the container and wipe when needed. The wipes retain its moisture fairly decently. I find that if I don’t use all of the wipes within a 2-3 month time frame, they will dry up and be no good. As long as you use them up before that it’s a nice buy for your vehicle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 6, 2024
P
Verified Purchase
PikachuLollipop
Omaha, US
★★★★★ 5
Smells good and conditions dash well
Dust is sticking to my dash more but that’s to be expected I think. My kid also starting trying to clean the back windows with them and they streaked them up, so not for windows. Seals tight, seems like they will last a while.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2024
D
Verified Purchase
Dan in Washington State
Phoenix, US
★★★★★ 5
Love that scent
I have been using Maguiar’s products for decades. I purchased these wipes shortly after I used one of their spray on detailing products in my garage. In that setting, the detail spray scent was addictive…almost like a tropical suntan lotion. Normally, I am not much on scents that can be overwhelming…like plug in house products or those things sit in your vehicle vents… they tend to be too strong and/or too pervasive. But in a garage, and diluted with the surrounding air…that detailing product scent was luscious, just enough, not too much. That scent prompted me to search online for “Maguiar’s wax scent” and I found some user forums discussing this topic. Lots of people think similar things and compare various other products. I learned that Maguiar’s recognized the marketing importance of scent in their products a while back, but I had never really noticed it, although it has always been my go to product line for wax and detailing products. This encouraged me to order some of these wipes for cleaning interior surfaces. I was not disappointed! The new car scent is just enough “new plastic” mixed with some sweetness of those other signature tropical notes to add a nice touch to the cleaning activity, while being just lightly persistent enough to make you notice that scent when you get into a freshly cleaned vehicle. I would not want that same scent to be too strong or persistent, and it is not. Additionally, as a cleaning product, it works very well. The dashboard plastics end up more matte than glossy with application, something else I appreciate. I am not a fan of super shiny or glossy. Thanks for a great product Maguiars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2021
A
Verified Purchase
ailf metairie
Grantham, US
★★★★★ 5
new car wipes
Car interior Looks good and smells great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
N
Verified Purchase
nick
Boise, US
★★★★★ 3
Not a clean wipe but smells good
Leaves behind a thick residue and makes a weird texture/coat on your interior
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2025

recommand products