Pay in installments of $32.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse IgG kappa, His tagProduct Specification Species Mouse Synonyms Ig kappa chain C region MOPC 21 Accession P01837 Amino Acid Sequence Protein sequence (P01837, Arg1 Cys107, with C 10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 6 kDa Observed MW: 13. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical
Product Specification
| Species | Mouse |
| Synonyms | Ig kappa chain C region MOPC 21 |
| Accession | P01837 |
| Amino Acid Sequence | Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 13.6 kDa Observed MW: 13.6 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy