SKU: 27174133701

Mouse GH Protein, His tag

Sale price$139.50 Regular price$155.00
Save 10%

Pay in installments of $38.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse GH Protein, His tagProduct Specification Species Mouse Synonyms Somatotropin, Growth hormone, Gh1 Accession P06880 Amino Acid Sequence Protein sequence (P06880, Phe27 Phe216, with C His tag) FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Expression System HEK293 Molecular Weight Predicted MW: 23. 5 kDa Observed MW: 23. 5 kDa

Product Specification


Species Mouse
Synonyms Somatotropin, Growth hormone, Gh1
Accession P06880
Amino Acid Sequence

Protein sequence (P06880, Phe27-Phe216, with C-His tag) FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Expression System HEK293
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 23.5 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Growth hormone (GH) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. GH also stimulates production of insulin-like growth factor 1 (IGF-1) and increases the concentration of glucose and free fatty acids. It is a type of mitogen which is specific only to the receptors on certain types of cells. GH is a single-chain polypeptide that is synthesized, stored and secreted by somatotropic cells within the lateral wings of the anterior pituitary gland.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27174133701

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Adrianna
Grantham, US
★★★★★ 5
Bully proof?!
Size: 5 in
We have the cutest little pit/lab mix who destroys stuffed toys in about two seconds flat. It’s always a HUNT to find toys he won’t instantly shred. This brand has some of the best! They were in FiveBelow for a while and it was the only brand that stood up to him initially. He finally got through the first only after MONTHS so we bought a few back ups and they’re still going strong months later! They’re also not super heavy so these end up being the toys we play fetch with most often! 100% will be buying more in this line in the future!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 15, 2024
C
Verified Purchase
Carol
Bozeman, US
★★★★★ 4
Great Option
Size: 5 in
When this chew arrived, it immediately became a favorite. It seems sturdy and is soft enough to be dental friendly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2024
S
Verified Purchase
Stardust
Charlottesville, US
★★★★★ 5
Love these!
Size: 5 in
My dogs finally chewed pieces off of these bones but it took forever for them to do it and they didn’t chew very much off! These are great and I will buy more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2023
T
Verified Purchase
Tina R Bergman
San Leandro, US
★★★★★ 1
She didn't even have this 5 minutes and got a big chunk off it.
Size: 5 in
Wasted money again. Big chunks came off. Took away in 5 minutes! BOO!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2023
M
Verified Purchase
Marsha Burke
Battle Creek, US
★★★★★ 1
Don’t buy
Size: 5 in
I bought one at a store for my Rottweiler puppy, about 2 months ago, I bought one from here n about 5 minutes she had chewed the end off, they did send me another, no charge, well I received the other bone yesterday, she chewed a big split in it. Won’t buy anymore, I’m out the money, which isn’t much. Made in China also, no more. Going back to Kong toys, they do last with aggressive chewers. Don’t know why but the one I bought at the store is holding up real good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2022

recommand products