SKU: 1529982199

TMIGD2/CD28H Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TMIGD2/CD28H Fc Chimera Protein, HumanProduct Specification Species Human Accession Q96BF3 Amino Acid Sequence Leu23 Gly150, with C terminal Human IgG1 Fc

Product Specification


Species Human
Accession Q96BF3
Amino Acid Sequence

Leu23-Gly150, with C-terminal Human IgG1 Fc LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 49-64kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Transmembrane and immunoglobulin domain containing 2 (TMIGD2)is new a immune checkpoint molecule of the B7:CD28 family which is a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins. TMIGD2 regulates cellular morphology, homophilic cell aggregation, and cell-cell interaction. TMIGD2 activity also modulates actin stress fiber formation and focal adhesion and reduces cell migration. Silencing of expression of TMIGD2 by small interfering RNA (siRNA) and by ectopic overexpression in endothelial cells showed that TMIGD2 regulates capillary tube formation in vitro, and B16F melanoma cells engineered to express TMIGD2 displayed extensive angiogenesis in the mouse Matrigel angiogenesis model. Moreover, TMIGD2, through its proline-rich cytoplasmic domain, associates with multiple Src homology 3 (SH3)-containing signaling proteins, including SH3 protein interacting with Nck (SPIN90/WISH), bullous pemphigoid antigen-1, and calcium channel β2.Silencing of expression of SPIN90/WISH by siRNA in endothelial cells showed that SPIN90/WISH is required for capillary tube formation. These features of TMIGD2 suggest that TMIGD2 is a novel receptor that plays an important role in cell-cell interaction, cell migration, and angiogenesis. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1529982199

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David Mapes
Charlottesville, US
★★★★★ 3
The book itself is good. The content may be awkward or detailed in ...
Format: Paperback
The book itself is good. The content may be awkward or detailed in a way that makes reading tedious and a bit less enjoyable than what likw.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2016
B
Verified Purchase
B.King
Natrona Heights, US
★★★★★ 5
Nursing school book that helps
Format: Paperback
I use this book for nursing school :0. The book covers a broad range of topics including cardiovascular diseases, respiratory conditions, diabetes, mental health, and much more. Each chapter is written by experts in the field, providing a high level of expertise and insight into best practices for managing various medical conditions. One of the things I appreciate about this book is the clear and concise writing style. The guidelines are presented in a format that is easy to understand and follow, making it an ideal resource for busy practitioners. Additionally, the authors have included helpful algorithms and decision trees to aid in the management of complex cases. Another strength of this book is the emphasis on evidence-based medicine. The guidelines are based on the latest research and are regularly updated to reflect new developments in the field. This ensures that healthcare professionals can provide the most effective and appropriate care for their patients. Overall, I highly recommend Clinical Guidelines in Primary Care for healthcare professionals working in primary care settings. It is a comprehensive and practical guide that provides evidence-based recommendations for the diagnosis and management of a wide range of medical conditions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2023
C
Verified Purchase
clarisse
Los Angeles, US
★★★★★ 5
Great Resource
Format: Paperback
As a resource for NP school (and even after, I'm sure), this book is fantastic. I recommend it to anyone asking if it's worth it. I, however, refer them to a different site than Amazon as it is cheaper straight from the publisher. Significantly so. A hundred dollars difference doesn't quite justify the next day or 2-day delivery.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2025
V
Verified Purchase
Val Mac
Battle Creek, US
★★★★★ 5
So good for soap notes!
Format: Paperback
I wish I could have gotten this sooner when we had to write soap notes. It explains the illness, symptoms, tests, treatments, referrals and follow ups. I got it used and it came in great condition. Would definitely buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2024
T
Verified Purchase
Taylor
Birmingham, US
★★★★★ 5
Bible!
Format: Paperback
This book has been my life line with school. Freaking amazing and worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2024

recommand products