Pay in installments of $20.49 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 2 - Aug 7
For Your Every Summer RSVP, with Code: SUMMER15
Description
motorfietshandschoen macna rigide bruinGemaakt met kwaliteitspapierfiltermateriaal in combinatie met de nieuwste in productietechnologien om maximale bescherming, prestaties en waarde te bieden
Gemaakt met kwaliteitspapierfiltermateriaal in combinatie met de nieuwste in productietechnologieën om maximale bescherming, prestaties en waarde te bieden
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
HTVRONT Sublimation Paper 8.5 x 11 inches – 150 Sheets (120gsm)
Size: 8.5"*11", Color: 150 sheets
As a novice in the world of sublimation printing, I was eager to find a reliable paper that would deliver vibrant, long-lasting transfers. The HTVRONT Sublimation Paper has exceeded my expectations in both quality and value.
Boasting an impressive over 98% transfer rate, this paper ensures that your prints are vivid and true to color, making it ideal for both personal and professional projects.The 120gsm weight provides a sturdy feel while allowing for quick drying, enabling faster turnaround times for your projects. Compatible with all inkjet printers that use sublimation ink, this paper is suitable for transferring designs onto a variety of surfaces, including T-shirts, mugs, tote bags, and more.he HTVRONT Sublimation Paper offers exceptional quality at a competitive price point, making it a top choice for both beginners and seasoned crafters. Its high transfer rate, durability, and ease of use make it a reliable option for a wide range of sublimation projects.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2025
★★★★★ 5
Great paper
Size: 8.5"*11", Color: 150 sheets
Worked great took colors good. Will buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
★★★★★ 5
Will purchase again
Size: 8.5"*11", Color: 150 sheets
Paper has a high quality fell takes ink well print quality is amazing did not have any issues with smudging can be use for many different projects
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
★★★★★ 5
High Transfer, Bright Colors & No Ghosting
Size: 8.5"*14", Color: 150 sheets, Size: 8.5"*14", Color: 150 sheets
This HTVRONT sublimation paper 8.5x14 inch has been excellent for my sublimation projects. The 120gsm weight feels sturdy and feeds smoothly through my inkjet printer without jams or curling. It holds ink well, which helps produce clean, sharp prints before pressing.
The transfer results are impressive. Colors come out vibrant and true, with strong detail and no dull or faded areas. I’ve had very little ghosting, and designs transfer evenly onto shirts, mugs, and other sublimation blanks. The claimed high transfer rate really shows in the final results.
I also like the larger 8.5x14 size, which gives extra space for bigger designs or multiple smaller prints on one sheet. The paper releases well during pressing, leaving minimal residue and clean edges.
Pros:
✔ Bright, vibrant color transfer
✔ Minimal ghosting or smudging
✔ Smooth printer feeding
✔ Great for shirts, mugs, and hard blanks
✔ Good value for the sheet count
Cons:
– Must be used with sublimation ink
– Requires correct heat press settings for best results
Overall, this HTVRONT sublimation paper is a reliable choice for anyone doing sublimation printing who wants strong color transfer, crisp detail, and consistent results. Great for both beginners and small business use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
★★★★★ 4
Thin but with extra step works great
Size: 8.5"*11", Color: 150 sheets
It sublimated great but it’s thinner than what I normally use so it take an extra step to not have over lapping but it’s cheaper and you get more so definitely worth the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
recommand products
afam kettingkit 520mx6 13 51 versterkte ultra light achter sprock 3038493
181.95
Sudio N3 White
49.99
afam kettingkit 525xhr3 17 40 super versterkte standaard achterste sprock 48012217
122.97
afam chain kit 525xsr2 16 41 super reincedced standaard achterste sprock 48012155
107.47
afam kettingkit 520xmr3 11 40 standaard standaard achterspellen 48013181
173.95