SKU: 97725754598

FABP3 His Tag, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 27 - Aug 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97725754598

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robbie
Carnegie, US
★★★★★ 5
Don’t rub, break it down between your fingers and dab!!
Style: 4 Fl Oz (Pack of 1)
Great sunscreen. The first time I applied it, i made the mistake of rubbing it in so it gave me a white cast. I learned my mistake the second time, spreading it in between my fingers and than dabbing it on my face, it gives a cast at first but after a few minutes it went away. And it feels so good. like I’m not wearing anything. I tried the tinted sunscreen it feels good but it made me look orange. I used to wear the Eucerin Daily Lotion spf 30 but they discontinued so I had to look for a replacement and after trying other sunscreens they were all terrible; greasy, allergic reactions and too creamy! This one’s perfect, it’s definitely my new go to!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
L
Verified Purchase
LylaStylus
Port Orchard, US
★★★★★ 5
The Only SPF My Skin Will Tolerate!
Style: 4 Fl Oz (Pack of 1)
After 20 rounds of radiation, I was given a list of exactly four things I could put on my face--things like water and Vaseline. Of course, I was also instructed to wear SPF in "all visible light." However, finding a sunscreen my skin could tolerate proved to be a challenge, as even those made with clean ingredients, marketed for babies, and/ or claiming to be hypoallergenic resulted in hot, angry rashes. Price point also didn't matter; I tried everything from drugstore to premium brands. Thankfully, when this product came on the market, my dermatologist suggested I try it. I've been wearing it ever since. It IS thick so I usually rub any remaining face moisturizer into my palms and then add the Sunscreen, rubbing and warming it between my palms to make it more easily spreadable. Then I press it onto the skin on my face with my palms and fingers--I don't like to pull or tug too much at the skin on my face. At first, there is a visible white cast, but it disappears within a couple of minutes. If I'm really in a hurry, now I can mix a tiny bit of my foundation into the sunscreen so that it spreads faster and I can move on from the white cast faster--I know I lose some sun protection factor that way, but my derm says I also gain some protection in the tinting, so it's okay. The important thing is that I get it on in whatever time I have. I'm just grateful to have found something that doesn't upset my crazy-sensitive skin! Wishing all you sensitive beauties protected fun in the sun...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
C
Verified Purchase
Christina A.
Natrona Heights, US
★★★★★ 4
Good sun protection without chemicals, without a high price.
Style: 4 Fl Oz (Pack of 1)
I've bought this a couple of times. I feel like it gives excellent sun protection at a reasonable price. I mostly use it on my face. When I first apply it, it looks a little white and pasty, but it doesn't take long for that to go away. It's a little greasy at first , but I have dry skin, so I it absorbs in. I like using a sunscreen that doesn't have a lot of chemicals. This works well while using ingredients I feel good about putting on my skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
T
Verified Purchase
TD
Bozeman, US
★★★★★ 5
A very effective sunscreen at a very reasonable price
Style: 4 Fl Oz (Pack of 1)
This sunscreen is very reasonably priced but would I love about this product more than anything is how effective it is at protecting your skin and will be my first go to when purchasing a sunscreen, and for a man, it is best to be clean shaven when using, and not to put on too much as it will make you look like Casper the ghost if you do
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Alvin English
Pawtucket, US
★★★★★ 5
No scent and blends in surprisingly well.
Style: 4 Fl Oz (Pack of 1)
Eucerin 50 (Sensitive Mineral - Zinc Oxide) Expiration date: Sept. 2026 Purchase date: May 2025 The most noticeable ingredients in the sunscreen are zinc oxide, mineral oil, and a yellow tint. The sunscreen is not scented which is always a plus. The yellow tint was not noticeable on my deep bronze skin. My skin is sensitive to many chemical products but not this one. The product blended in well into my skin both when dry and when using a moisturizing toner. There was not a white cast after giving it a few minutes to be absorbed by the skin. Most oil-based sunscreens leave my skin feeling greasy when perspiring but the Eucerin 50 was a pleasant surprise. The perspiration felt normal and not greasy. Overall, I am very pleased with the product. It is great for active people who normally sweat away sunscreen. Eucerin 50 left my skin feeling very soft after washing it off. This is the first mineral oil-based sunscreen that I have found to be satisfactory. I believe it to be a good value at the twenty-dollar or less price range. Warning!: It can stain your clothing. Do not store oil-based sunscreens in a hot environment like your automobile. The ingredients will separate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2025

recommand products