SKU: 9355137261

IL-7 Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Pay in installments of $29.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-7 Protein, HumanProduct Specification Species Human Synonyms Interleukin 7 Accession P13232 Amino Acid Sequence Asp26 His177 with C terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH Expression System HEK293 Molecular Weight 18 30 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU mg Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Interleukin-7
Accession P13232
Amino Acid Sequence

Asp26-His177 with C-terminal 6*His Tag

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Expression System HEK293
Molecular Weight 18-30 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 10 mM PBS, pH 7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9355137261

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kateisha
Fort Morgan, US
★★★★★ 5
Great Denim jacket!
I purchased a 2xl for my husband and it's a great quality and price. He really loves it. It's a good stretch and he's able to place a hoodie or a thicker shirt and still be comfortable if need be. Will be purchasing him another color of this jeans jacket.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
M
Verified Purchase
Murphy
Whiting, US
★★★★★ 5
Good Value Denim Jacket With True to Size Fit
Great denim jacket for the price. It feels durable and well made, though the quality is not quite on par with higher end name brands, which is to be expected at this price point. The fit is true to size and matches expectations. It is comfortable out of the box and, like most denim, should become even more comfortable as it breaks in over time. The arm length runs slightly long, but if you usually find sleeves long on jackets, this one will fit similarly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
N
Verified Purchase
Nicholas
New York, US
★★★★★ 5
Great base to add patches to
I've bought this jacket twice now (lost the first one...). Great base for my DIY patch jackets. I buy an XL even though it's a size too large for me. It's a standard denim jacket, not much to write home about. Good pocket size, and I appreciate the functional chest pockets.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
Verified Purchase
jose
Port Orchard, US
★★★★★ 5
Chanclas
Size: 4 Big Kid, Color: Black
Excelentes chanclas.. buen material
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
J
Verified Purchase
Joyce Mills
Natrona Heights, US
★★★★★ 5
Good crocs and cute
Size: 12 Little Kid, Color: Black
Birthday gift for my grandson and he loves them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products