SKU: 9276043004

Her3 His Tag Protein, Rhesus macaque

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, Rhesus macaqueProduct Specification Species Rhesus macaque Synonyms Her3, FERLK, LCCS2, VSCN1 Accession G7N7B1 Amino Acid Sequence Ser20 His641, with C terminal 10* His Tag

Product Specification


Species Rhesus macaque
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession G7N7B1
Amino Acid Sequence

Ser20-His641, with C-terminal 10* His Tag SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWKDIVRDQDAEIVVKDNGRSCPLCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMYNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-94kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9276043004

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
J. Taylor
Chelsea, US
★★★★★ 5
Tried the wife’s stuff, and it’s a better tool for the job.
Husband review: The wife ordered this stuff for herself, skeptical about what’s in a lot of cosmetics. I always went straight for good ol’ Carmex; but I tried it once because I was too lazy to dig around for mine. This stuff is sometimes a better tool for the job. I service swimming pools and work outside in the sun, so I sometimes struggle with dehydration & get cracked lips occasionally. I put this on before bed, and it lasts all night so I wake up better off. It’s not medicated (what she wanted), but it’s hydrating. So while I still occasionally use Carmex at work, reapplying a few times to get damaged cracks together, I use this to maintain & finish the job overnight where the other stuff would have just evaporated within an hour. Another thing: it’s soft, where chap stick would pull on a sore/crack, this stuff goes on an into damaged places like a lubricant.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2024
M
Verified Purchase
MKAT
Draper, US
★★★★★ 3
Very moisturizing but no honey flavor and can get greasy
The product is very moisturizing, that's for sure. Tube is large which makes for a messy application on a warm day. Was fine when temp dropped to 77 as shown in picture. Better to dab on with your finger regardless imo. No honey scent or flavor whatsoever which is greatly disappointing. I checked multiple times that I didn't accidently order a plain one. Had a faint meaty scent which is barely noticeable (I'm okay with that knowing it's all natural versus something with chemicals) but then it shouldn't be called "honey glazed". Would have been 5 stars if i wasnt misled and it was advertised as plain (or indicated that you don't taste the honey but it's there to neutralize the tallow flavor), also it could use some (more) beeswax to make it more stable. Suggest re-marketing it in a round tin as an all around balm and making a smaller tube with more beeswax for a lip balm. Versus a traditional lip balm, would recommend this product if you are okay with the nuances noted above.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2024
U
Verified Purchase
User 1
Boise, US
★★★★★ 4
What changed in the formula?? Now a chemical smell. 😕
What changed?? I got one in the fall and LOVED it more than any lip balm ever! But I just got two more (one for my car and one for my bag) and it has a strong chemical smell. I’ve used it for a week, hoping the smell would fade somehow, but it hasn’t. I would love an answer from the company about what changed. And please change back to the original formula! It was lovely, smooth with a slight sweet taste from the honey. The first one was 5 stars, and now I would say 2 at most, so I tried to average it at 4 stars (with hope for a change).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2025
H
Verified Purchase
Heather M
Los Angeles, US
★★★★★ 1
Warning!!! Contaminated!!!!
This is the second time I've ordered this lip balm. The first time, the lip balm was great, unscented and worked well, so well that i ordered another to keep in the car. I ordered the same one, just 3 ingredients - tallow, beeswax, and honey. Except this one is contaminated with some kind of chemicals! It leaves an awful taste that permeates my whole mouth. It's like chemicals or strong perfume and kind of stings! Not only am i disappointed but I'm furious because my child used it first! We still have the awful taste in our mouths and I'm concerned what kind of chemicals we might have just been exposed to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2024
M
Verified Purchase
Melissa Oestreich
Fort Morgan, US
★★★★★ 5
Must have for chapped/dry lips
Unfortunately for me, my lips dry easily. Wearing myotape (mouth tape) at night reduces how often my lips get chapped and peel. However, my lips still need regular care. I have been using chapstick that doesn't contain standard endocrine disruptors, petrochemicals, and artificial dyes for years. Since there's concern about the high omega 6 content (and possible inflammatory repurcussions) of using chapsticks that contain sunflower seed oil, etc. In them, I decided to try beef tallow. Most beef tallows come in tins and must be applied by hand, and then the hands must be washed. This product gives you the ability to apply beef tallow to your lips without having to directly apply your fingers to your lips. This is a must have!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2025

recommand products