SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shutthefrontdoor
Houston, US
★★★★★ 5
Understated and pl
Color: 03# Gold
The sparkle effect is pretty muted and understated, which I appreciate. No adverse skin reaction and I have sensitive skin. I’m yet to test it in the sun
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
M
Verified Purchase
Maria
Cuba, US
★★★★★ 5
Nice recommended
Color: 01# Golden Amber, Color: 01# Golden Amber
Very smooth lotion makes your skin feel dewy. Very light smell of coconut. And protect you from UVs rays. It really glows
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
A
Verified Purchase
Amanda
Natrona Heights, US
★★★★★ 3
Sticky, I’d hate it all over my body. Shimmer is light but glittery.
Color: 02# Rose Gold
Very sticky formula, wore it over regular sunscreen bf I didn’t want to feel that sticky so I only added it to certain spots like my color bones. I’d probably skip next time and just use a highlight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
S
Verified Purchase
Saoirse Leahy
Los Angeles, US
★★★★★ 5
Absolutely love and fully worth it
Color: 02# Rose Gold, Color: 02# Rose Gold
I love this product now you can see a little bit of shimmer on my skin, but it’s hard because I’m pale. I will update this with a picture when I get a Tan.. but it smells absolutely delightful. I’m glad I’ve purchased this over the high priced fenty body lava .. and I love it because of the SPF in it . I’m definitely going to purchase the other shades.. it smells like you are on the beach.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
G
Verified Purchase
Gretchen Miller
Louisville, US
★★★★★ 5
Worth every penny!!
Absolutely love everything about this body wash! Has a wonderful lather, leaves your skin feeling clean and moisturized. The bottle is cute , and the smell is heavenly!! It will definitely last a long time cause a little bit goes a long way!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026

recommand products