SKU: 91511261901

Human RUNX1, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human RUNX1, His tagProduct Specification Species Human Synonyms Acute myeloid leukemia 1 protein, Core binding factor subunit alpha 2 (CBF alpha 2), Oncogene AML 1,PEA2 alpha B,PEBP2 alpha B, SL3 3 enhancer factor 1 alpha B subunit, SL3 AKV core binding factor alpha B subunit, AML1, CBFA2 Accession Q01196 Amino Acid Sequence Protein sequence(Q01196 Ser50 Leu183, with C 10*His)

Product Specification


Species Human
Synonyms Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2
Accession Q01196
Amino Acid Sequence

Protein sequence(Q01196 Ser50-Leu183, with C-10*His)
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:16.7kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Runt-related transcription factor 1 (RUNX1) also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2) is a protein that in humans is encoded by the RUNX1 gene. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. In addition it plays a major role in the development of the neurons that transmit pain. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91511261901

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chezza
New York, US
★★★★★ 5
Well made and durable.
Color: Carbonized, Size: 3-piece
I'm thrilled with these boards, Just the right size for individual jobs. Well made, wash up beautifully and I highly recommend them. Great value for the money too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
A
Verified Purchase
Anthony
Bozeman, US
★★★★★ 5
Solid bamboo board set for the price
Color: Carbonized, Size: 3-piece
This bamboo cutting board set has been a nice addition to my kitchen. I like having different sizes available, and I especially appreciate being able to reduce how often I use plastic cutting boards. Mine did have a strong odor at first, but after washing them and letting them air out, that went away. They also seem good for the price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
T
Verified Purchase
Teresa
Carnegie, US
★★★★★ 5
Wood cutting boatds
Color: Carbonized, Size: 3-piece
These are great cuting boards. I love the different sizes. Great quality product, easy to use, easy to clean, sturdy, bamboo material is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
D
Verified Purchase
Davejayhawk
Lake Worth, US
★★★★★ 4
Awesome Boards….BUT the Smell!!!!
Color: Carbonized, Size: 3-piece
I’d love to give these 5 stars, they are heavy, well made, smooth, deep juice grooves, just nice….but the smell! I washed them, then used vinegar on them, set them outside over night, washed them again….its better but still present. I’d love some guidance on this. I’m hoping it goes away in a few days. It’s like a very strong woodsy smell that actually made my whole kitchen smell like these boards! Edit: Ok, here's what I did. Washed, let dry, coated and scrubbed with apple cider vinegar, set them in a high air flow area for 24 hours (I put mine outside on the patio over night), washed and scrubbed again, let dry, scrubbed with lemons and salt, let dry, washed again. Finally, there is still a slight smell if you push them against your nose but that seems to be fading as well. So, great boards if you want to go stubbornly go through the smell removal process. I don't think it's a chemical smell, I think it's processed bamboo that is shrink wrapped in air tight packaging too soon after manufacturing. Anyway, I'll move this to 4 stars....but lots of work involved here!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Shannon Latham
New York, US
★★★★★ 5
Obsessed with these boards!!
Color: Carbonized, Size: 3-piece
I love these cutting boards! It’s one of those items you don’t even know you need until you get them. Three perfect smaller sizes that can be used for so many different serving ideas. Great quality, great price. Definitely worth the buy!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products