SKU: 90836870024

NKp30/CD337 Fc Chimera Protein, Human

Sale price$198.00 Regular price$220.00
Save 10%

Pay in installments of $55.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NKp30/CD337 Fc Chimera Protein, HumanProduct Specification Species Human Accession O14931 Amino Acid Sequence Leu19 Thr138, with C terminal human IgG1 Fc

Product Specification


Species Human
Accession O14931
Amino Acid Sequence Leu19-Thr138, with C-terminal human IgG1 Fc LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 55-65 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Natural killer protein 30 (NKp30; also known as natural cytotoxicity receptor 3, NCR3; or CD337) is an Ig-like activating receptor of NK cells regulating the cross talk between NK and dendritic cells. It is expressed on the surface of NK cells, recently-expanded γδT cells, activated CD8 cells, and innate lymphocytes. The extracellular part of NKp30 consists of a single N-terminal Ig-like domain, followed by a distinct 15 amino acids long stalk region proximal to the plasma membrane, which is important for receptor signaling. Further, three specific cellular ligands of NKp30 have been identified. NKp30 binds a member of B7 family, in particular B7 homolog 6 (B7-H6). Interaction of NCR3 with B7H6 leads to activation of NK cells and induces cytolysis of target cells resulting in apoptotic cell death. Another NKp30 cellular ligand, BAG-6 is recruited to the cell membrane and interacts with NKp30 in some tumor cells or under the stress conditions. The most recently discovered NKp30 ligand, galectin 3, expressed on the surface of some tumors, almost completely blocks NK cell cytotoxicity. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90836870024

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Argelis Rodriguez
Dallas, US
★★★★★ 5
Super good quality!
Size: 1.3 Fl Oz (Pack of 1)
Ooof!! This one right here is good for super dry skin!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
S
Verified Purchase
snowdrop
Carnegie, US
★★★★★ 5
Obsessed. Soothing, effective, fragrance-free, incredibly healing
Style: Tolerance Daily Foaming Facial Cleanser
I’ve been loving this so much I bought a second bottle after a few days of using it. It has all the skin soothing benefits of the tolerance lotion cleanser, but it’s also a really great cleanser. It’s almost not noticeable how good it is at cleansing because your skin doesn’t feel stripped after, but it takes things off really quickly. I was worried because it doesn’t foam a lot and it feels so nurturing — much like the tolerance lotion cleanser (which I use as a second cleanse when my skin needs a few days to recover from something like a derm office treatment) — but when I wash again with my favorite HG cleanser nothing extra comes off, and I tested it twice on waterproof eyeliner that I’d swiped on my forearm for an hour or so, the eyeliner dissolved and wiped off with two or three gentle swipes. It has a very emollient texture, so when you rub it against your skin it slips so easily you don’t realize it’s dissolving and taking things away because there is no friction. So it’s great at taking off makeup, it’s AMAZING at cleaning makeup brushes, and IT DOES NOT BURN MY EYES AT ALL. Also, it is FRAGRANCE-FREE… before I bought it I read a review complaining about smelling a citrus fragrance, that person either has some sort of brain tumor or something spilled on their bottle when it was in a warehouse because this is definitely a fragrance-free product. Prior to trying this, I had tried another cleanser that gave me weird acne hives all over my chest (never happened to me before) and I was struggling to heal the acne and the irritation. I noticed an immediate difference when I started using the tolerance cleanser on it; the fresh redness went away, the acne started healing, and the post-inflammatory hyperpigmentation has been healing fast. So I’ve been using this on my body as well and it’s soothing and moisturizing in all the places where other things have been drying. I have mild rosacea and I hadn’t realized how irritated my skin was from the last thing I’d tried until after 5 days or so of using this my skin tone looked much more even and the stubborn PIH I have from a two-zit hormonal breakout a month ago finally looked dramatically lighter (as recently as the week before, I’d needed to cover them with high-coverage concealer). Because this doesn’t foam much, some people might not realize how well it’s cleaning… I encourage you to judge it based on how your skin looks and feels. Since it is very emollient though, I do think it’s important to use it with a face wash scrubber or washcloth just to ensure you’re getting some mild mechanical exfoliation and clearing away skin cells that could be trapping stuff in your pores. For this reason, I do wash my face with this twice so the first wash can get off makeup/debris/oil and then the second wash can really penetrate and clean my skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
B
Verified Purchase
BlackHeartNY
Birmingham, US
★★★★★ 5
No Scent and Gentle
Style: Tolerance Daily Foaming Facial Cleanser
I broke out in a case of Perioral Dermatitis recently and bought this product to help before I could see my doctor. Avene Tolerance facial cleanser has no scent and is very gentle on my skin. It didn’t burn when washing with this product, and even helped to slough off the dead skin around my lips. My face feels clean, not dry. I am still going to see my doc to get an RX for the inflammation, but I do believe this product helped to alleviate the dryness and tightness of my skin and lips. I’ve used other Avene products and I’m very happy with them. Even though these products are more expensive, to me they are well worth the money because they are much more gentle on the skin than any other products I’ve used. I will buy this product again just because of the fact that it’s so gentle. PS: at the time of purchase for this product, I also bought Avene’s Tolerance Control Skin Recovery Cream (you don’t need to use a lot of this one on your entire face), and Avene’s Cicalfate for lips. Between these 3 products, my lips and skin feel a lot better (however, I will still see my doctor because I have Crohn’s Disease and Perioral Dermatitis is considered an extra-intestinal side effect of Crohn’s).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
T
Verified Purchase
Taylor Ashley
Boise, US
★★★★★ 5
Gentle everyday cleanser!
Style: Tolerance Daily Foaming Facial Cleanser
My go to nightly cleanser! Gentle yet effective. Removes makeup without leaving any residue behind. Also does not dry out my skin or cause breakouts! I would say it’s more of a cream cleanser though. It does not really foam up. It’s a decent size bottle for the price. The pump dispenser is an added plus!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
T
Verified Purchase
Tee Hix
Waukegan, US
★★★★★ 5
So gentle and moisturizing. Great for super sensitive skin.
Style: Tolerance Daily Foaming Facial Cleanser
This is so gentle and moisturizing. Does not irritate my skin in any way. My skin is super sensitive and I have atopic dermatitis, it has been the best cleanser I’ve used to date. I was using another one from this brand and it was fine but this is the one I will continually stick with from now on. Just hope they don’t change the formula.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products