SKU: 90387555975

VHL/Elongin-C/Elongin-B Complex Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Pay in installments of $29.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL/Elongin-C/Elongin-B Complex Protein, HumanProduct Specification Species Human Antigen ELOB ELOC VHL Synonyms Elongin B & Elongin C & VHL, ELOB & ELOC & VHL Complex, Elongin B & Elongin C & VHL Complex Accession Q15370Q15369P40337 Amino Acid Sequence ELOB flag tag, Human, Asp2 Gln118, N flag DYKDDDDKDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ ELOC flag tag, Human, Asp2 Cys112, N flag

Product Specification


Species Human
Antigen ELOB/ELOC/VHL
Synonyms Elongin B & Elongin C & VHL, ELOB & ELOC & VHL Complex, Elongin B & Elongin C & VHL Complex
Accession Q15370、Q15369、P40337
Amino Acid Sequence

ELOB flag tag, Human, Asp2-Gln118, N-flag DYKDDDDKDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ ELOC flag tag, Human, Asp2-Cys112, N-flag DYKDDDDKDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC VHL His tag, Human, Pro2-Asp213, N-His HHHHHHHHHHGGGSGGGSPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Expression System Baculovirus-InsectCells
Molecular Weight 14 kDa (ElOB) and 13.3 kDa (ElOC) and 25.9 kDa (VHL)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 40mM Tris, 200mM NaCl, 2.2mM KCl, 20% glycerol, 3mM DTT, pH8.0
Reconstitution N.A
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1.Cell Chem Biol. 2023 Jul 20;30(7):766-779.e11. Epub 2023 Jun 23.
2.bioRxiv. 2023 May 24;2023.05.22.541439. PreprintOkumura F., et al. (2012) Front. Oncol.
3.Mod Pathol. 2023 Apr 23;36(8):100194. Online ahead of print.

Background

ELOB (elongin B) is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. ELOB and ELOC(elongin C) form a heterodimer that serves as the regulatory subunit for the Elongin complex-a general transcription elongation factor that increases RNA Polymerase II transcription through template-encoded arresting sites. The ELOB/ELOC complex also binds to the "BC-box motif" found in many proteins in the VHL-box and SOCS-box protein families. The VHL(von Hippel-Lindau disease tumor suppressor) binds to ELOB and ELOC and thereby inhibits transcription elongation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90387555975

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michele Martinez
Lake Worth, US
★★★★★ 5
Great buy
Size: Giant, Style: 40 Count
These pads are great. Absorbent and leak resistant. Very roomy for my chihuahua to turn in her inconsistent circles before and durable enough for her to "dig" after without ripping or bunching up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
R
Ryan
Port Orchard, US
★★★★★ 5
Solid interactive automatic vibrating dog ball toy
Color: Blue, Color: Blue
Picked up this ITEHZTO interactive automatic vibrating dog ball for our pup and it’s a fun, engaging toy that keeps her entertained. It’s rechargeable with USB, motion-activated, and has a good vibrating/rolling action that gets her chasing and playing on her own. The durable build seems like it can handle some rough play, and it’s a nice size for indoor or outdoor use. It lights up or vibrates when activated which adds extra excitement, especially during evening playtime. Battery life is decent and recharges quickly. Great for when she needs mental and physical stimulation without me having to throw a ball constantly. Overall a solid interactive dog toy that does a great job keeping active dogs busy. Good value if your dog loves chasing moving/vibrating toys!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
C
Chris Brundige
Whiting, US
★★★★★ 4
Built-in USB-C solves the power issue, but it is strictly for moderate chewers
Color: Blue
Got this to keep the high-energy puppy occupied indoors so the older dogs can actually get some peace and quiet. The main issue with most automated electronic pet toys is that they rely on expensive, hard-to-find button cell batteries that die after a single afternoon of use. This unit utilizes a built-in 300mAh battery with a standard Type-C charging interface. That is a mandatory design feature if you actually want to run the toy daily without going broke replacing power cells. The internal motor generates enough erratic movement to keep a dog's attention, and it actually has the torque to navigate over standard tile, hardwood, and light carpets without instantly stalling out in a corner. You need to completely understand the physical limitations of what you are unboxing here. The listing explicitly states this is not for heavy chewers, and you need to take that warning seriously. The outer shell is TPU, but the internal chassis housing the electronics is hard ABS plastic. If you hand this to an 80-pound working dog that aggressively shreds thick bones, they are going to crush the housing and destroy the internal motor assembly in about ten minutes. At roughly 2.5 inches in diameter, it's basically the size of a standard tennis ball. If you use it as intended—as an interactive chasing toy for a puppy or a moderate chewer rather than a heavy-duty chew toy—it functions perfectly. It is a highly practical piece of indoor enrichment gear. Solid return on investment for burning off excess canine energy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
T
The Florida Fam
West Palm Beach, US
★★★★★ 5
Pawsitively Stimulating🐾
Color: Blue
When my hooman brought this home, I thought it was fur their computer. After all, it has a plug and lights up. When they placed it on the floor, I was pawsomely surprised. Fur real, this little ball is wierd. It doesn't taste at all like my favorite tennis ball. I was a pawplexed that sometimes when I was finally brave enough to get it and hold it in my mouth, it would start jumping around. I think my hoomans finally found a toy that will keep me busy for a while. Mom is howling with excitement because it kept me interested for a long time. I hope I can sleep tonight. I see mom has plugged in my new toy to keep it "charged"- whatever that means....I never had a toy that came with its own leash before. Mom says she is gonna save the toy until other hoomans come over to keep me from being too ruff with them. You see the video, do I look a dog who could be too ruff?- Sincerely, the family dog, a bona-fido toy reviewer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
R
Rick G
Pawtucket, US
★★★★★ 4
Freaks my dogs out.
Color: Blue, Color: Blue
My dogs really don't know what to make of these. They mostly follow it around, staring at it curiously, but semi-afraid to approach it. That, or they'll bark at it. It charges quickly and has multiple modes to engage your pet with. It also locks closed securely ... for the most part. That said, there are some downsides. This toy is mostly made for smaller dogs. I'd say 40 or 50 pounds max. While the plastic shell feels hard and durable, it's not hard enough for a big dog's jaws. My big bulldog mix bore down on this with his teeth, and I hard the plastic starting to snap. It's tough, but not great if your dog is the type who likes to put the pressure on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products