SKU: 88329316415

CD48 His Tag Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD48 His Tag Protein, HumanProduct Specification Species Human Antigen CD48 Synonyms BCM1, SLAMF2, BLAST, BLAST1, MEM 102, TCT. 1, BCM 1, SLAMF 2 Accession P09326 1 Amino Acid Sequence Gln27 Ser220, with C terminal 8*His Tag QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 45kDa

Product Specification


Species Human
Antigen CD48
Synonyms BCM1, SLAMF2, BLAST, BLAST1, MEM-102, TCT.1, BCM-1, SLAMF-2
Accession P09326-1
Amino Acid Sequence

Gln27-Ser220, with C-terminal 8*His Tag QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-45kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Shannon L McArdel. Roles of CD48 in regulating immunity and tolerance. Clin Immunol. 2016 Mar; 164:10-20.Epub 2016 Jan 18.

Background

CD48, a member of the signaling lymphocyte activation molecule family, participates in adhesion and activation of immune cells. Although constitutively expressed on most hematopoietic cells, CD48 is upregulated on subsets of activated cells. CD48 can have activating roles on T cells, antigen presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD244:CD48 interactions regulate target cell lysis by NK cells and CTLs, which are important for viral clearance and regulation of effector/memory T cell generation and survival.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88329316415

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
mike
Houston, US
★★★★★ 5
Super soft
Color: Gray, Size: King
Nice and soft. Love to snuggle under. Warm but not too hot. Size perfect for my bed. Will definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
P
Verified Purchase
patricia aulabaugh
Dallas, US
★★★★★ 5
Super soft
Color: Cypress, Size: King
Super soft and warm, very nice to sleep with
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026
M
Verified Purchase
MunchkinsMomsez
Waukegan, US
★★★★★ 3
No cat claws allowed!
Color: Cypress, Size: Twin, Color: Cypress, Size: Twin
The quality of this set isn't the best. It you have a cat, a sharp claw or two will do visible damage! I actually clipped the loose threads off days ago, but there's still that double track of claw marks that will always be there. The pillow sham is also huuuge and looks awkward on a twin bed. It you have a large pillow it should be ok. The pillow sham isn't sewn together properly either, the fabric is bunched up where the seams meet. The comforter is pretty lightweight, so I will definitely be needing another blanket (or two!) with this one for winter. However, the set IS very soft, and it IS nice and cozy. The color in person is ok/does not look like photo advertised, as is, it would probably look nicer on a better quality set. The three stars is for comfort only. I will update this review after washing it a couple of times. Update: not even a month, and the fabric has ripped where the claw mark is. But, I have decided to keep it after all, if only for the comfort. Still not happy with the cost vs the quality. Latest update: added last 2 photos to show progression of wear. It does wash up well enough all considered. 3/31/24 Tears in the material (non-sherpa side) continue to appear. If you apply any type of tension to the fabric while making the bed, or just trying to pull the comforter over you when you roll over, you can hear the fabric tearing. I have found 6 tears to date.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2023
J
Verified Purchase
John cromwell
Belleville, US
★★★★★ 5
Finally we BOTH can sleep comfy!
Color: 08 - Black, Size: Queen
So for years my boyfriend has always liked “jersey sheets” or “tee shirt” sheets or sheets made of flannel. He says he doesn’t like the feeling of cold “silky” feeling sheets as he’s always cold. I’m opposite and am always hot, and anytime we stayed in a nice hotel I looked forward to being able to sleep on cooler, taught, soft sheets for a couple of nights. I was able to deal with our old sheets but the issue we both hated was after awhile any sheet we got would get pilling. We even splurged and got a $60 flannel sheet which did the same thing forcing me to shave off these little annoying fuzz balls that make it feels like there is thousands of crumbs on the sheets. I also would wash our bedding once a week because the Jersey sheets seemed to “grow” as we move around in bed making it so the sheet was not taught and super annoying to lay on. The day I would wash them they would be comfortable but ultimately by the end of the week they would be almost hanging off our mattress. I ordered these sheets on a whim and got them the same day and immediately just threw out the jersey sheet and put this on (I didn’t even wash it, I know it’s gross but I was desperate for a comfy nights sleep and they came around 8pm) when I put them on I realized how soft and comfortable they felt. I also liked how the pillow cases are larger than most pillow cases that I have had in the past. We’ve been using these sheets for about a week and I love how I don’t wake up with my pillow popping out of the case anymore. The sheets have loosed ever so slightly since a week of sleeping but still are really taught and comfortable. They are cooler than flannel or fabric sheets and are initially cold when you first lay on them but I wouldn’t consider them “cooling” but they keep me from feeing extremely hot. They are way better than I ever would have expected for the price. I look forward to laying on them at the end of each day, even my boyfriend laid in bed the day I got them and said “wow I didn’t think I would like sheets like this, these are so soft!” And fell asleep immediately. We ended up ordering a second set in grey and the color is pretty. I still have yet to wash them, I usually use 2 tide pods when washing the bedding but I might get some fabric softener (as I hear it helps with pilling) to prevent the possibility of having that happen to these sheets in the future. I am hoping they hold up well after the wash and longer use. If they start to pill after wash, I will come back and update my review. Until then, I would highly recommend these sheets for the quality and the price point that they are offered at. Honestly, at this point even if they pill months from now I probably wouldn’t even be upset as long as they stay the same price I would just buy another set as they are just that comfortable and soft. UPDATE: So it has been about 3 months since I have purchase and used these sheets. They are still as soft as the day I first put them on. I’ve been washing them bi-weekly along with my comforter and pillowcases. I wash them with warm water using a combination of tide pods and added Downy fabric softener. They say to hang dry them in the description but I have been putting them in the dryer on medium and have been taking them out after around 20-25 minutes, they seem to dry extremely quickly. They have yet to have absolutely any pilling and also have not shrunk or stretched. Also I have a cat that is very active and also sleeps with me who enjoys kneading on my bed and I haven’t even noticed any signs of wear what so ever to the eye or to the feel. I highly recommend these sheets. I still have yet to even open the second set I purchased!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2024
J
Verified Purchase
Joy Joy
Lake Worth, US
★★★★★ 5
Happy With Our Purchase
Color: 07 - Charcoal, Size: King, Color: 07 - Charcoal, Size: King
When we opened the package the sheets were soft. We wash everything before we use it, so in these went. The sheets held nicely through the washing machine, the edges stayed sewn up and the sheets are still fluffy. The sheets fit nicely on our bed and have a nice cooling effect in this 80-degree weather. We think these sheets were a quality purchase that was affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products